Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397S2P5

Protein Details
Accession A0A397S2P5   
Localization Confidence High
Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
12-33NDKEWTRNKCRRFLRFVQKDLTHydrophilic
204-224VEIKTKERRGFPKKLKIDEKIBasic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto 5
Family & Domain DBs
Amino Acid Sequences MDIPIEQQFDINDKEWTRNKCRRFLRFVQKDLTSSRIEKEPGDENRLFLPKYFKLVVDKDREFYKWKSKELFNIFVAIFRFLHEYYPDINRLELHTNHSEKINEWSEYLADNSENKEAQIQNKFINEVNVKWLPGFEYLYDFEYKRGVHRGDLIFADNHGILAAVETKTKWKNVKNQTIKYRNILMEETENDPRIITVIGCYFVEIKTKERRGFPKKLKIDEKIWMAIKKVNDEFNKKSPNSNQLSTAHTMGSETSRELEEEQETDDLDLET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.36
3 0.44
4 0.5
5 0.56
6 0.61
7 0.66
8 0.74
9 0.75
10 0.77
11 0.8
12 0.81
13 0.81
14 0.8
15 0.78
16 0.71
17 0.65
18 0.58
19 0.52
20 0.45
21 0.38
22 0.35
23 0.33
24 0.32
25 0.29
26 0.3
27 0.35
28 0.35
29 0.41
30 0.38
31 0.34
32 0.38
33 0.41
34 0.37
35 0.3
36 0.33
37 0.27
38 0.32
39 0.31
40 0.28
41 0.31
42 0.36
43 0.42
44 0.44
45 0.44
46 0.41
47 0.42
48 0.42
49 0.41
50 0.4
51 0.44
52 0.4
53 0.44
54 0.48
55 0.48
56 0.55
57 0.57
58 0.57
59 0.47
60 0.45
61 0.39
62 0.36
63 0.33
64 0.26
65 0.19
66 0.14
67 0.16
68 0.13
69 0.15
70 0.13
71 0.14
72 0.14
73 0.17
74 0.19
75 0.17
76 0.17
77 0.16
78 0.18
79 0.21
80 0.2
81 0.22
82 0.26
83 0.27
84 0.28
85 0.29
86 0.27
87 0.23
88 0.28
89 0.26
90 0.21
91 0.19
92 0.19
93 0.17
94 0.17
95 0.17
96 0.11
97 0.08
98 0.08
99 0.1
100 0.11
101 0.1
102 0.1
103 0.13
104 0.14
105 0.18
106 0.21
107 0.22
108 0.22
109 0.23
110 0.24
111 0.21
112 0.24
113 0.2
114 0.16
115 0.2
116 0.18
117 0.18
118 0.16
119 0.16
120 0.12
121 0.13
122 0.13
123 0.07
124 0.09
125 0.1
126 0.11
127 0.13
128 0.12
129 0.11
130 0.13
131 0.13
132 0.12
133 0.16
134 0.15
135 0.15
136 0.2
137 0.21
138 0.21
139 0.21
140 0.21
141 0.16
142 0.15
143 0.15
144 0.09
145 0.08
146 0.06
147 0.06
148 0.04
149 0.05
150 0.07
151 0.06
152 0.06
153 0.07
154 0.11
155 0.13
156 0.18
157 0.23
158 0.27
159 0.37
160 0.47
161 0.58
162 0.63
163 0.7
164 0.76
165 0.78
166 0.76
167 0.69
168 0.65
169 0.55
170 0.48
171 0.4
172 0.31
173 0.26
174 0.26
175 0.26
176 0.22
177 0.22
178 0.19
179 0.18
180 0.16
181 0.14
182 0.12
183 0.08
184 0.08
185 0.08
186 0.09
187 0.09
188 0.1
189 0.1
190 0.1
191 0.15
192 0.15
193 0.19
194 0.28
195 0.35
196 0.39
197 0.46
198 0.56
199 0.59
200 0.68
201 0.73
202 0.74
203 0.75
204 0.8
205 0.81
206 0.76
207 0.72
208 0.69
209 0.63
210 0.59
211 0.56
212 0.48
213 0.42
214 0.4
215 0.38
216 0.37
217 0.36
218 0.38
219 0.4
220 0.46
221 0.5
222 0.55
223 0.62
224 0.56
225 0.6
226 0.59
227 0.62
228 0.61
229 0.58
230 0.54
231 0.48
232 0.52
233 0.48
234 0.42
235 0.32
236 0.26
237 0.23
238 0.19
239 0.19
240 0.15
241 0.13
242 0.14
243 0.14
244 0.16
245 0.16
246 0.18
247 0.17
248 0.17
249 0.18
250 0.17
251 0.17
252 0.16