Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397S545

Protein Details
Accession A0A397S545   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
287-316KDNRDYCTKKYDRCKKHKSKGCKCDYNDIEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 12.5, cyto 8, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003365  Viral_rep_N  
Gene Ontology GO:0016888  F:endodeoxyribonuclease activity, producing 5'-phosphomonoesters  
GO:0016779  F:nucleotidyltransferase activity  
GO:0006260  P:DNA replication  
GO:0018142  P:protein-DNA covalent cross-linking  
Pfam View protein in Pfam  
PF02407  Viral_Rep  
Amino Acid Sequences MNLTQYQKFIEKYNLPNSPNSRKLFIKYFYITNKKERYNNKFGSDLSLRLSLAKIEKDIKFQKQLDDWEYSDFFEGKNYSTTYKNDNYIYSNIEIIYKMMEISKLKYIKIESPNFNNISTIYIKTLFYGDEEENNYWPTRYNEVNFKYRFNSEYKIEFRNNTLSLMYWDPNNSLKFLSCDFNRREWINDKFSGYYCKNIINNDKKYVDFEWKFLIKFYNKCTFTIWKNLINFLPENDDKIKYIVWQLELVKMKNLMFKVMFNLMNIYIKKIFNDNSIHLENTKGSFKDNRDYCTKKYDRCKKHKSKGCKCDYNDIEHRCEMCNEKCKRIIARNEIKIREYDLNLNDFIGPFEEEEKKRNQELLEDEMLEDLKIDGYTLDDFVLKYGVLYKGWLKTNFIKEFFMCKLMIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.55
3 0.61
4 0.65
5 0.66
6 0.67
7 0.63
8 0.59
9 0.55
10 0.59
11 0.59
12 0.55
13 0.53
14 0.48
15 0.52
16 0.56
17 0.62
18 0.6
19 0.62
20 0.67
21 0.66
22 0.71
23 0.74
24 0.74
25 0.74
26 0.77
27 0.71
28 0.67
29 0.6
30 0.6
31 0.52
32 0.44
33 0.37
34 0.33
35 0.28
36 0.26
37 0.26
38 0.21
39 0.22
40 0.22
41 0.22
42 0.27
43 0.29
44 0.36
45 0.43
46 0.46
47 0.51
48 0.52
49 0.54
50 0.52
51 0.56
52 0.52
53 0.49
54 0.43
55 0.39
56 0.38
57 0.32
58 0.29
59 0.23
60 0.19
61 0.18
62 0.18
63 0.14
64 0.17
65 0.18
66 0.18
67 0.22
68 0.25
69 0.28
70 0.31
71 0.34
72 0.33
73 0.34
74 0.35
75 0.33
76 0.34
77 0.28
78 0.24
79 0.2
80 0.19
81 0.17
82 0.13
83 0.12
84 0.09
85 0.08
86 0.08
87 0.11
88 0.11
89 0.14
90 0.21
91 0.22
92 0.22
93 0.25
94 0.27
95 0.32
96 0.39
97 0.44
98 0.42
99 0.46
100 0.53
101 0.52
102 0.49
103 0.42
104 0.33
105 0.29
106 0.25
107 0.2
108 0.15
109 0.15
110 0.15
111 0.15
112 0.16
113 0.12
114 0.11
115 0.14
116 0.12
117 0.14
118 0.17
119 0.18
120 0.18
121 0.19
122 0.19
123 0.15
124 0.17
125 0.16
126 0.17
127 0.19
128 0.21
129 0.28
130 0.33
131 0.41
132 0.4
133 0.4
134 0.39
135 0.38
136 0.38
137 0.32
138 0.32
139 0.26
140 0.32
141 0.33
142 0.36
143 0.36
144 0.35
145 0.34
146 0.35
147 0.33
148 0.27
149 0.23
150 0.18
151 0.18
152 0.19
153 0.17
154 0.12
155 0.12
156 0.13
157 0.17
158 0.17
159 0.15
160 0.13
161 0.13
162 0.14
163 0.15
164 0.18
165 0.15
166 0.22
167 0.24
168 0.27
169 0.3
170 0.29
171 0.31
172 0.33
173 0.37
174 0.35
175 0.34
176 0.32
177 0.3
178 0.3
179 0.33
180 0.28
181 0.25
182 0.21
183 0.23
184 0.23
185 0.25
186 0.34
187 0.36
188 0.38
189 0.4
190 0.41
191 0.37
192 0.38
193 0.36
194 0.36
195 0.28
196 0.26
197 0.25
198 0.26
199 0.25
200 0.24
201 0.26
202 0.21
203 0.23
204 0.27
205 0.32
206 0.32
207 0.32
208 0.35
209 0.35
210 0.34
211 0.4
212 0.38
213 0.33
214 0.33
215 0.34
216 0.32
217 0.29
218 0.27
219 0.19
220 0.22
221 0.17
222 0.19
223 0.19
224 0.2
225 0.18
226 0.18
227 0.18
228 0.13
229 0.16
230 0.15
231 0.13
232 0.16
233 0.16
234 0.21
235 0.24
236 0.23
237 0.22
238 0.22
239 0.21
240 0.22
241 0.21
242 0.18
243 0.16
244 0.16
245 0.17
246 0.2
247 0.2
248 0.16
249 0.18
250 0.16
251 0.2
252 0.19
253 0.2
254 0.19
255 0.18
256 0.19
257 0.21
258 0.21
259 0.22
260 0.26
261 0.25
262 0.27
263 0.28
264 0.28
265 0.25
266 0.25
267 0.21
268 0.2
269 0.21
270 0.15
271 0.17
272 0.22
273 0.25
274 0.33
275 0.35
276 0.36
277 0.42
278 0.46
279 0.46
280 0.51
281 0.54
282 0.52
283 0.6
284 0.67
285 0.69
286 0.76
287 0.84
288 0.85
289 0.9
290 0.92
291 0.92
292 0.93
293 0.92
294 0.92
295 0.9
296 0.82
297 0.82
298 0.76
299 0.74
300 0.71
301 0.65
302 0.59
303 0.53
304 0.5
305 0.41
306 0.4
307 0.37
308 0.36
309 0.41
310 0.41
311 0.44
312 0.47
313 0.51
314 0.56
315 0.59
316 0.61
317 0.62
318 0.68
319 0.71
320 0.75
321 0.72
322 0.67
323 0.59
324 0.54
325 0.49
326 0.41
327 0.38
328 0.33
329 0.34
330 0.32
331 0.32
332 0.27
333 0.22
334 0.2
335 0.15
336 0.12
337 0.1
338 0.14
339 0.21
340 0.22
341 0.26
342 0.32
343 0.36
344 0.38
345 0.41
346 0.37
347 0.36
348 0.39
349 0.41
350 0.38
351 0.33
352 0.31
353 0.28
354 0.27
355 0.21
356 0.16
357 0.1
358 0.08
359 0.07
360 0.07
361 0.06
362 0.07
363 0.09
364 0.09
365 0.09
366 0.1
367 0.1
368 0.1
369 0.11
370 0.09
371 0.08
372 0.12
373 0.14
374 0.13
375 0.16
376 0.2
377 0.26
378 0.33
379 0.35
380 0.36
381 0.43
382 0.53
383 0.57
384 0.55
385 0.53
386 0.48
387 0.52
388 0.49
389 0.43