Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SKX7

Protein Details
Accession A0A397SKX7    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
143-167IQKIEKMGWKKRFVRNERARRRELWHydrophilic
NLS Segment(s)
PositionSequence
151-164WKKRFVRNERARRR
Subcellular Location(s) mito 21, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR024388  Ribosomal_L20_mt  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF12824  MRP-L20  
Amino Acid Sequences MSLLIKKILFTPPSTISTISLFIPNHIFIRTYTAKKPIKPSNSSAPIYAEEELEDGSKFISRVPLYPQKISLDELPPPLNPIKQKSYNLTQEQINEIKQLREQDPIKWTRKKLAEKFECSQFYIGIIAPVSEERRIELEAENIQKIEKMGWKKRFVRNERARRRELW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.32
3 0.27
4 0.27
5 0.26
6 0.21
7 0.22
8 0.18
9 0.18
10 0.2
11 0.2
12 0.19
13 0.18
14 0.18
15 0.13
16 0.21
17 0.26
18 0.27
19 0.3
20 0.38
21 0.43
22 0.46
23 0.55
24 0.56
25 0.59
26 0.59
27 0.61
28 0.62
29 0.64
30 0.61
31 0.53
32 0.46
33 0.4
34 0.37
35 0.32
36 0.21
37 0.14
38 0.13
39 0.12
40 0.1
41 0.08
42 0.06
43 0.05
44 0.06
45 0.06
46 0.06
47 0.11
48 0.11
49 0.12
50 0.19
51 0.28
52 0.3
53 0.31
54 0.33
55 0.3
56 0.31
57 0.31
58 0.27
59 0.2
60 0.18
61 0.19
62 0.18
63 0.16
64 0.17
65 0.16
66 0.16
67 0.16
68 0.19
69 0.23
70 0.26
71 0.29
72 0.31
73 0.36
74 0.41
75 0.41
76 0.39
77 0.35
78 0.31
79 0.32
80 0.3
81 0.24
82 0.19
83 0.18
84 0.16
85 0.17
86 0.19
87 0.17
88 0.23
89 0.23
90 0.24
91 0.31
92 0.38
93 0.44
94 0.46
95 0.47
96 0.48
97 0.55
98 0.61
99 0.62
100 0.65
101 0.66
102 0.67
103 0.69
104 0.69
105 0.63
106 0.54
107 0.47
108 0.36
109 0.28
110 0.22
111 0.18
112 0.12
113 0.09
114 0.08
115 0.07
116 0.09
117 0.1
118 0.11
119 0.11
120 0.11
121 0.13
122 0.14
123 0.15
124 0.14
125 0.16
126 0.2
127 0.23
128 0.23
129 0.21
130 0.21
131 0.2
132 0.19
133 0.19
134 0.21
135 0.27
136 0.36
137 0.45
138 0.55
139 0.63
140 0.71
141 0.79
142 0.8
143 0.81
144 0.83
145 0.85
146 0.87
147 0.87