Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TK86

Protein Details
Accession A0A397TK86   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
117-147YVWYGRLKEKQYQKRWNKKRKNLADLPDNFRHydrophilic
NLS Segment(s)
PositionSequence
131-136RWNKKR
Subcellular Location(s) nucl 17, mito_nucl 13.333, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
Amino Acid Sequences MPPIVDSINKSPNNRHNPIYPSAVLDQVKKIGKEFLESRLRPIVQPIVIPKAITPSISQRLEPPKPFPGAFPTLTPFQKQLLRKYLNCWKNRTIMQNNKEWLAEEKFNLYLKRRAIYVWYGRLKEKQYQKRWNKKRKNLADLPDNFRPHSILRRSDKVEILS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.59
3 0.56
4 0.57
5 0.59
6 0.56
7 0.46
8 0.41
9 0.38
10 0.39
11 0.34
12 0.31
13 0.28
14 0.28
15 0.31
16 0.27
17 0.27
18 0.26
19 0.24
20 0.28
21 0.28
22 0.31
23 0.38
24 0.37
25 0.4
26 0.42
27 0.42
28 0.37
29 0.38
30 0.34
31 0.25
32 0.27
33 0.26
34 0.24
35 0.24
36 0.23
37 0.2
38 0.19
39 0.19
40 0.17
41 0.16
42 0.17
43 0.24
44 0.25
45 0.26
46 0.27
47 0.35
48 0.39
49 0.4
50 0.38
51 0.35
52 0.37
53 0.37
54 0.32
55 0.29
56 0.28
57 0.26
58 0.23
59 0.22
60 0.23
61 0.24
62 0.23
63 0.19
64 0.18
65 0.22
66 0.24
67 0.27
68 0.32
69 0.36
70 0.36
71 0.41
72 0.47
73 0.5
74 0.51
75 0.5
76 0.44
77 0.45
78 0.49
79 0.51
80 0.52
81 0.54
82 0.53
83 0.54
84 0.52
85 0.48
86 0.44
87 0.37
88 0.31
89 0.26
90 0.24
91 0.18
92 0.18
93 0.19
94 0.22
95 0.23
96 0.23
97 0.24
98 0.25
99 0.26
100 0.25
101 0.23
102 0.24
103 0.29
104 0.32
105 0.35
106 0.39
107 0.4
108 0.42
109 0.47
110 0.47
111 0.47
112 0.52
113 0.53
114 0.58
115 0.67
116 0.75
117 0.81
118 0.89
119 0.92
120 0.93
121 0.93
122 0.94
123 0.93
124 0.92
125 0.9
126 0.87
127 0.86
128 0.82
129 0.79
130 0.76
131 0.68
132 0.58
133 0.51
134 0.45
135 0.39
136 0.41
137 0.41
138 0.42
139 0.47
140 0.55
141 0.59
142 0.62