Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397SX98

Protein Details
Accession A0A397SX98    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-35NSNKLKRLETNSIKSKQKKREIERDINHAKNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR012459  Rrp15  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF07890  Rrp15p  
Amino Acid Sequences MGRVNSNKLKRLETNSIKSKQKKREIERDINHAKNRQNEPVRKENFDMKEIKNIDKQEETLSETVSGNSSIISSDEDSMNYNSIPKMKKPSKNTTSSFAETMNKLLTAPVNQTPVLSRSKGIEREIDEAKLEYKARRAISMEKKKLASKDRVKADLTSIDYERKLRKLATRGVVQLFNAIRKSQKTTDDVIKAVGGEPKLTSRDAEDVANMSKETFLDFLKGGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.7
3 0.74
4 0.77
5 0.8
6 0.82
7 0.81
8 0.82
9 0.83
10 0.83
11 0.86
12 0.87
13 0.88
14 0.84
15 0.83
16 0.82
17 0.79
18 0.76
19 0.71
20 0.66
21 0.64
22 0.64
23 0.64
24 0.65
25 0.65
26 0.66
27 0.7
28 0.69
29 0.64
30 0.62
31 0.61
32 0.54
33 0.52
34 0.51
35 0.42
36 0.46
37 0.45
38 0.45
39 0.42
40 0.4
41 0.39
42 0.35
43 0.34
44 0.28
45 0.27
46 0.27
47 0.22
48 0.21
49 0.19
50 0.17
51 0.16
52 0.14
53 0.12
54 0.08
55 0.08
56 0.07
57 0.06
58 0.06
59 0.07
60 0.07
61 0.08
62 0.09
63 0.09
64 0.11
65 0.11
66 0.11
67 0.1
68 0.1
69 0.1
70 0.14
71 0.16
72 0.17
73 0.26
74 0.34
75 0.42
76 0.49
77 0.59
78 0.61
79 0.67
80 0.67
81 0.63
82 0.61
83 0.55
84 0.48
85 0.39
86 0.33
87 0.26
88 0.24
89 0.18
90 0.13
91 0.1
92 0.1
93 0.09
94 0.08
95 0.1
96 0.11
97 0.12
98 0.12
99 0.12
100 0.12
101 0.14
102 0.16
103 0.14
104 0.12
105 0.13
106 0.17
107 0.2
108 0.2
109 0.21
110 0.21
111 0.25
112 0.25
113 0.23
114 0.2
115 0.17
116 0.17
117 0.16
118 0.15
119 0.12
120 0.15
121 0.19
122 0.19
123 0.21
124 0.22
125 0.29
126 0.39
127 0.49
128 0.5
129 0.5
130 0.52
131 0.53
132 0.57
133 0.55
134 0.54
135 0.53
136 0.56
137 0.57
138 0.59
139 0.57
140 0.52
141 0.47
142 0.42
143 0.36
144 0.31
145 0.26
146 0.25
147 0.25
148 0.28
149 0.29
150 0.26
151 0.26
152 0.26
153 0.31
154 0.36
155 0.42
156 0.44
157 0.45
158 0.47
159 0.48
160 0.46
161 0.39
162 0.38
163 0.32
164 0.29
165 0.26
166 0.23
167 0.23
168 0.24
169 0.31
170 0.3
171 0.35
172 0.36
173 0.39
174 0.46
175 0.46
176 0.44
177 0.39
178 0.34
179 0.29
180 0.26
181 0.25
182 0.17
183 0.14
184 0.14
185 0.17
186 0.18
187 0.19
188 0.18
189 0.17
190 0.21
191 0.21
192 0.21
193 0.19
194 0.2
195 0.21
196 0.22
197 0.19
198 0.16
199 0.15
200 0.14
201 0.14
202 0.13
203 0.12
204 0.13