Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SLR6

Protein Details
Accession A0A397SLR6    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-27GKPSKASRRNGIIRLRQRQKLKNTSHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, mito_nucl 13.5, mito 6.5
Family & Domain DBs
Amino Acid Sequences MGKPSKASRRNGIIRLRQRQKLKNTSHVKQIKVKEEEISDLQIEVQRLNKFINEAGEKIFNGFMRSEWEKQNLLKWINFYTAQIKDMEKELYLNNLRTEAIEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.81
3 0.8
4 0.78
5 0.79
6 0.8
7 0.8
8 0.8
9 0.77
10 0.77
11 0.77
12 0.72
13 0.74
14 0.71
15 0.66
16 0.63
17 0.63
18 0.61
19 0.56
20 0.54
21 0.46
22 0.41
23 0.4
24 0.33
25 0.28
26 0.19
27 0.15
28 0.14
29 0.13
30 0.13
31 0.1
32 0.13
33 0.12
34 0.13
35 0.13
36 0.13
37 0.12
38 0.12
39 0.16
40 0.12
41 0.13
42 0.13
43 0.14
44 0.13
45 0.13
46 0.14
47 0.1
48 0.1
49 0.1
50 0.09
51 0.14
52 0.18
53 0.2
54 0.22
55 0.25
56 0.26
57 0.27
58 0.31
59 0.32
60 0.31
61 0.3
62 0.29
63 0.28
64 0.29
65 0.28
66 0.25
67 0.25
68 0.24
69 0.24
70 0.23
71 0.22
72 0.2
73 0.22
74 0.22
75 0.16
76 0.16
77 0.16
78 0.22
79 0.26
80 0.27
81 0.26
82 0.26
83 0.26