Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SBR0

Protein Details
Accession A0A397SBR0   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
100-132SELVFMKKSRKNHHQKKRKKTSGKKIHYLMERKBasic
NLS Segment(s)
PositionSequence
106-126KKSRKNHHQKKRKKTSGKKIH
Subcellular Location(s) mito 13, mito_nucl 13, nucl 11
Family & Domain DBs
Amino Acid Sequences MSKLTRLPYFVSNVAWELVDFLHWSMVYAKDFGTTLESARRALNKFKEEANSDKVTSFWQNSSSFLNMLRTAVDLNTNKILNRVSDLHDDVSQTIFNKVSELVFMKKSRKNHHQKKRKKTSGKKIHYLMERK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.2
3 0.16
4 0.12
5 0.1
6 0.09
7 0.08
8 0.07
9 0.08
10 0.08
11 0.09
12 0.1
13 0.12
14 0.13
15 0.13
16 0.12
17 0.12
18 0.12
19 0.12
20 0.13
21 0.11
22 0.11
23 0.15
24 0.16
25 0.16
26 0.18
27 0.22
28 0.21
29 0.28
30 0.34
31 0.32
32 0.33
33 0.35
34 0.37
35 0.36
36 0.38
37 0.37
38 0.32
39 0.3
40 0.28
41 0.26
42 0.24
43 0.22
44 0.19
45 0.14
46 0.15
47 0.15
48 0.17
49 0.18
50 0.17
51 0.15
52 0.14
53 0.15
54 0.11
55 0.11
56 0.1
57 0.08
58 0.08
59 0.07
60 0.12
61 0.11
62 0.13
63 0.15
64 0.16
65 0.15
66 0.17
67 0.17
68 0.12
69 0.15
70 0.15
71 0.15
72 0.19
73 0.2
74 0.2
75 0.2
76 0.21
77 0.18
78 0.17
79 0.15
80 0.12
81 0.12
82 0.11
83 0.1
84 0.1
85 0.11
86 0.1
87 0.11
88 0.13
89 0.15
90 0.19
91 0.23
92 0.3
93 0.34
94 0.42
95 0.49
96 0.58
97 0.66
98 0.72
99 0.79
100 0.83
101 0.89
102 0.92
103 0.95
104 0.94
105 0.94
106 0.94
107 0.95
108 0.95
109 0.94
110 0.92
111 0.87
112 0.84