Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SG40

Protein Details
Accession A0A397SG40    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
24-53EDVPKNILHNQNNKKKQKQKVSQPENYTSDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
CDD cd00590  RRM_SF  
Amino Acid Sequences NTRSKPYNTNPPPKNSSSAGGSKEDVPKNILHNQNNKKKQKQKVSQPENYTSDMETDESIIKETYGSSSNTSTPSPSESTSTSSSGASPQTADTPHSADQNKEILHDDHRTNQNEDDPKSEPIPIPICVRYEIATPATSILEDTQNDIKRRTLQVIDIPLNLKAASVRARFKRYGEITRLTMRTRGLFQHAYIEYLSPDEFYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.6
3 0.54
4 0.49
5 0.48
6 0.43
7 0.39
8 0.37
9 0.37
10 0.43
11 0.41
12 0.37
13 0.33
14 0.33
15 0.34
16 0.41
17 0.44
18 0.43
19 0.51
20 0.59
21 0.68
22 0.76
23 0.8
24 0.82
25 0.83
26 0.86
27 0.86
28 0.86
29 0.87
30 0.88
31 0.88
32 0.87
33 0.84
34 0.81
35 0.74
36 0.67
37 0.56
38 0.45
39 0.36
40 0.28
41 0.22
42 0.15
43 0.13
44 0.11
45 0.1
46 0.11
47 0.1
48 0.09
49 0.08
50 0.08
51 0.09
52 0.09
53 0.1
54 0.11
55 0.13
56 0.14
57 0.16
58 0.16
59 0.15
60 0.14
61 0.16
62 0.16
63 0.15
64 0.16
65 0.15
66 0.19
67 0.2
68 0.2
69 0.18
70 0.17
71 0.16
72 0.15
73 0.15
74 0.11
75 0.09
76 0.08
77 0.09
78 0.09
79 0.1
80 0.1
81 0.12
82 0.13
83 0.17
84 0.17
85 0.16
86 0.17
87 0.19
88 0.18
89 0.17
90 0.18
91 0.14
92 0.16
93 0.2
94 0.19
95 0.22
96 0.28
97 0.29
98 0.29
99 0.29
100 0.32
101 0.33
102 0.33
103 0.3
104 0.26
105 0.26
106 0.25
107 0.25
108 0.2
109 0.19
110 0.2
111 0.19
112 0.19
113 0.19
114 0.19
115 0.19
116 0.2
117 0.17
118 0.16
119 0.16
120 0.15
121 0.13
122 0.12
123 0.12
124 0.11
125 0.1
126 0.09
127 0.09
128 0.1
129 0.1
130 0.13
131 0.18
132 0.24
133 0.26
134 0.27
135 0.28
136 0.3
137 0.33
138 0.34
139 0.29
140 0.28
141 0.31
142 0.37
143 0.36
144 0.33
145 0.32
146 0.28
147 0.27
148 0.23
149 0.17
150 0.11
151 0.12
152 0.17
153 0.21
154 0.28
155 0.34
156 0.41
157 0.43
158 0.45
159 0.52
160 0.51
161 0.55
162 0.54
163 0.52
164 0.51
165 0.56
166 0.57
167 0.49
168 0.46
169 0.4
170 0.37
171 0.35
172 0.34
173 0.34
174 0.33
175 0.31
176 0.37
177 0.34
178 0.33
179 0.3
180 0.27
181 0.21
182 0.2
183 0.19