Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SAU9

Protein Details
Accession A0A397SAU9   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
17-40CSSVSTSHGRKKRKHNARSVAASDHydrophilic
NLS Segment(s)
PositionSequence
26-31RKKRKH
Subcellular Location(s) nucl 20, cyto_nucl 14.333, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003656  Znf_BED  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF02892  zf-BED  
Amino Acid Sequences MSESDTDTTVTHSSITCSSVSTSHGRKKRKHNARSVAASDNDRPIPTIAGRANQSHTSYFFYKDSSNNEIAYCIICKQNPETKAYPYSRKGGSTSNMSNHLRDKHGITKHNYLDYLDGNNEVNYKKKKLHDIDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.13
4 0.13
5 0.14
6 0.14
7 0.17
8 0.21
9 0.27
10 0.35
11 0.42
12 0.49
13 0.56
14 0.66
15 0.74
16 0.78
17 0.81
18 0.82
19 0.85
20 0.85
21 0.84
22 0.77
23 0.7
24 0.62
25 0.56
26 0.47
27 0.41
28 0.33
29 0.26
30 0.23
31 0.19
32 0.18
33 0.15
34 0.18
35 0.15
36 0.17
37 0.19
38 0.2
39 0.22
40 0.23
41 0.24
42 0.2
43 0.2
44 0.21
45 0.2
46 0.21
47 0.19
48 0.18
49 0.18
50 0.19
51 0.22
52 0.22
53 0.22
54 0.21
55 0.2
56 0.19
57 0.17
58 0.15
59 0.12
60 0.09
61 0.09
62 0.09
63 0.1
64 0.14
65 0.2
66 0.21
67 0.26
68 0.27
69 0.29
70 0.36
71 0.39
72 0.42
73 0.39
74 0.42
75 0.39
76 0.38
77 0.36
78 0.33
79 0.32
80 0.32
81 0.33
82 0.31
83 0.37
84 0.37
85 0.37
86 0.37
87 0.37
88 0.33
89 0.32
90 0.33
91 0.34
92 0.4
93 0.44
94 0.46
95 0.51
96 0.52
97 0.54
98 0.5
99 0.43
100 0.39
101 0.34
102 0.31
103 0.23
104 0.21
105 0.18
106 0.18
107 0.2
108 0.18
109 0.24
110 0.27
111 0.31
112 0.36
113 0.42
114 0.52