Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397S6K8

Protein Details
Accession A0A397S6K8   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPPVRRDKEKVERTRKRKSLSYAEKKRLCIBasic
NLS Segment(s)
PositionSequence
6-19RDKEKVERTRKRKS
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011335  Restrct_endonuc-II-like  
Gene Ontology GO:0006302  P:double-strand break repair  
Amino Acid Sequences MPPVRRDKEKVERTRKRKSLSYAEKKRLCILPDYEEYNSEGSESNFDWDQEIDKIISELQNIIDALNLQDPIVAEKFIHIDDEIPIGLLSDEEIIDAVISNPEKNDIEEEEKSEEINIITNKEALNSLERTVYAMASTSSNAEDSVRYSPYYLTRSQARSQAPPTTNTQETKELVLAKDRLLAKELDLAKDSLLAKELDLAKDRLLALPQEESEEYTGSRELVLRENVSLDAYLKYRERDPDLPVLIYLDNGTIKAHELLTLPHSTASATIKVAMGAWNRQDLKYGDHATLILGANCSKEPDSWVRPKNRIRPGPGAPAANNLGAAYPTMIIEVGHTQSLPDLHRKVALYFSPRTTIQIVLLVKIFKPKRNNTITLIAAKYVRTSQTPLIPEQVISFGTATPHRSTINYITNTMGVPQNHFIVFGRRDPVTSNNYPTCNMAGIGTYIMNIPANELFYGDITVRPFTLAMNQGFNLDLYEIQEAIVDEFNI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.9
3 0.86
4 0.84
5 0.81
6 0.81
7 0.82
8 0.84
9 0.84
10 0.86
11 0.85
12 0.79
13 0.76
14 0.7
15 0.61
16 0.58
17 0.52
18 0.48
19 0.47
20 0.49
21 0.44
22 0.4
23 0.39
24 0.32
25 0.27
26 0.21
27 0.17
28 0.13
29 0.15
30 0.14
31 0.16
32 0.16
33 0.16
34 0.16
35 0.16
36 0.17
37 0.15
38 0.16
39 0.13
40 0.13
41 0.13
42 0.14
43 0.15
44 0.13
45 0.13
46 0.11
47 0.14
48 0.13
49 0.13
50 0.11
51 0.1
52 0.11
53 0.12
54 0.11
55 0.09
56 0.1
57 0.1
58 0.13
59 0.14
60 0.13
61 0.1
62 0.11
63 0.13
64 0.12
65 0.13
66 0.1
67 0.1
68 0.11
69 0.12
70 0.11
71 0.1
72 0.09
73 0.08
74 0.08
75 0.07
76 0.06
77 0.05
78 0.05
79 0.05
80 0.05
81 0.04
82 0.04
83 0.05
84 0.05
85 0.07
86 0.08
87 0.08
88 0.09
89 0.12
90 0.13
91 0.13
92 0.15
93 0.16
94 0.21
95 0.22
96 0.24
97 0.24
98 0.24
99 0.23
100 0.21
101 0.18
102 0.12
103 0.16
104 0.14
105 0.13
106 0.13
107 0.15
108 0.15
109 0.14
110 0.15
111 0.12
112 0.15
113 0.15
114 0.15
115 0.15
116 0.15
117 0.16
118 0.15
119 0.14
120 0.1
121 0.09
122 0.08
123 0.08
124 0.09
125 0.08
126 0.08
127 0.08
128 0.08
129 0.09
130 0.08
131 0.1
132 0.12
133 0.12
134 0.12
135 0.13
136 0.14
137 0.19
138 0.22
139 0.21
140 0.22
141 0.27
142 0.32
143 0.34
144 0.39
145 0.38
146 0.39
147 0.41
148 0.46
149 0.41
150 0.39
151 0.42
152 0.4
153 0.41
154 0.37
155 0.37
156 0.32
157 0.32
158 0.3
159 0.27
160 0.24
161 0.21
162 0.24
163 0.22
164 0.18
165 0.22
166 0.22
167 0.2
168 0.2
169 0.19
170 0.15
171 0.21
172 0.22
173 0.17
174 0.17
175 0.17
176 0.15
177 0.19
178 0.19
179 0.12
180 0.12
181 0.11
182 0.1
183 0.14
184 0.16
185 0.13
186 0.15
187 0.16
188 0.14
189 0.16
190 0.17
191 0.13
192 0.12
193 0.11
194 0.1
195 0.1
196 0.1
197 0.1
198 0.1
199 0.1
200 0.1
201 0.1
202 0.09
203 0.08
204 0.08
205 0.07
206 0.07
207 0.08
208 0.08
209 0.11
210 0.12
211 0.12
212 0.12
213 0.13
214 0.12
215 0.11
216 0.1
217 0.08
218 0.08
219 0.08
220 0.1
221 0.1
222 0.11
223 0.13
224 0.16
225 0.2
226 0.21
227 0.24
228 0.27
229 0.27
230 0.26
231 0.23
232 0.22
233 0.17
234 0.14
235 0.11
236 0.06
237 0.05
238 0.05
239 0.06
240 0.04
241 0.05
242 0.06
243 0.06
244 0.06
245 0.07
246 0.07
247 0.1
248 0.11
249 0.1
250 0.09
251 0.09
252 0.08
253 0.09
254 0.1
255 0.09
256 0.08
257 0.09
258 0.09
259 0.09
260 0.09
261 0.11
262 0.1
263 0.11
264 0.12
265 0.16
266 0.17
267 0.17
268 0.2
269 0.18
270 0.2
271 0.24
272 0.26
273 0.21
274 0.2
275 0.2
276 0.17
277 0.19
278 0.16
279 0.1
280 0.09
281 0.09
282 0.09
283 0.09
284 0.1
285 0.08
286 0.08
287 0.11
288 0.17
289 0.23
290 0.32
291 0.39
292 0.44
293 0.52
294 0.6
295 0.66
296 0.7
297 0.7
298 0.67
299 0.67
300 0.66
301 0.66
302 0.61
303 0.54
304 0.45
305 0.41
306 0.37
307 0.29
308 0.24
309 0.15
310 0.12
311 0.1
312 0.09
313 0.06
314 0.05
315 0.05
316 0.05
317 0.05
318 0.04
319 0.05
320 0.07
321 0.07
322 0.07
323 0.07
324 0.07
325 0.08
326 0.11
327 0.12
328 0.16
329 0.17
330 0.17
331 0.21
332 0.22
333 0.22
334 0.24
335 0.25
336 0.25
337 0.26
338 0.27
339 0.28
340 0.27
341 0.29
342 0.26
343 0.23
344 0.19
345 0.21
346 0.2
347 0.18
348 0.19
349 0.18
350 0.16
351 0.24
352 0.27
353 0.27
354 0.36
355 0.42
356 0.5
357 0.56
358 0.6
359 0.56
360 0.6
361 0.57
362 0.53
363 0.47
364 0.39
365 0.33
366 0.29
367 0.25
368 0.21
369 0.2
370 0.17
371 0.2
372 0.22
373 0.27
374 0.29
375 0.29
376 0.31
377 0.29
378 0.28
379 0.25
380 0.23
381 0.16
382 0.15
383 0.13
384 0.1
385 0.12
386 0.14
387 0.16
388 0.17
389 0.19
390 0.19
391 0.19
392 0.24
393 0.28
394 0.35
395 0.34
396 0.33
397 0.32
398 0.32
399 0.31
400 0.29
401 0.26
402 0.18
403 0.2
404 0.2
405 0.22
406 0.21
407 0.22
408 0.2
409 0.23
410 0.26
411 0.26
412 0.27
413 0.25
414 0.26
415 0.28
416 0.33
417 0.34
418 0.36
419 0.4
420 0.41
421 0.43
422 0.44
423 0.43
424 0.38
425 0.31
426 0.26
427 0.19
428 0.14
429 0.13
430 0.13
431 0.11
432 0.1
433 0.09
434 0.1
435 0.1
436 0.09
437 0.11
438 0.11
439 0.12
440 0.12
441 0.12
442 0.12
443 0.11
444 0.13
445 0.11
446 0.12
447 0.13
448 0.14
449 0.13
450 0.14
451 0.13
452 0.12
453 0.18
454 0.22
455 0.23
456 0.26
457 0.26
458 0.26
459 0.26
460 0.26
461 0.2
462 0.14
463 0.13
464 0.11
465 0.12
466 0.11
467 0.11
468 0.12
469 0.12
470 0.13