Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397RYB8

Protein Details
Accession A0A397RYB8    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
50-73YTTKRRGRVFILCKKNKKHKQRQGBasic
NLS Segment(s)
PositionSequence
63-71KKNKKHKQR
Subcellular Location(s) mito 19, nucl 4.5, cyto_nucl 4, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MSLLTQLSRTTFLSSRLSSLWQSSLLLNSFNLTRGMKVRSSVKKFCDGCYTTKRRGRVFILCKKNKKHKQRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.25
4 0.27
5 0.23
6 0.23
7 0.21
8 0.16
9 0.16
10 0.14
11 0.15
12 0.13
13 0.13
14 0.11
15 0.1
16 0.1
17 0.1
18 0.11
19 0.09
20 0.1
21 0.12
22 0.14
23 0.14
24 0.16
25 0.23
26 0.3
27 0.36
28 0.4
29 0.41
30 0.48
31 0.48
32 0.48
33 0.48
34 0.42
35 0.41
36 0.47
37 0.51
38 0.51
39 0.55
40 0.59
41 0.53
42 0.57
43 0.57
44 0.57
45 0.6
46 0.61
47 0.68
48 0.72
49 0.78
50 0.82
51 0.87
52 0.87
53 0.88