Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TGP0

Protein Details
Accession A0A397TGP0    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MMTHLSKRKLLLKKQKKRGPYFTRITKKSHydrophilic
NLS Segment(s)
PositionSequence
7-19KRKLLLKKQKKRG
Subcellular Location(s) nucl 13.5, mito 10, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MMTHLSKRKLLLKKQKKRGPYFTRITKKSTYFDKYRPNGSFTRAAKGTLNILTLINKQSNPDDFNEVLDDVKNKYNDQLKLKIRIENLRIKLKEKQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.86
3 0.87
4 0.87
5 0.87
6 0.85
7 0.83
8 0.82
9 0.81
10 0.84
11 0.77
12 0.73
13 0.68
14 0.63
15 0.58
16 0.56
17 0.52
18 0.48
19 0.52
20 0.57
21 0.55
22 0.58
23 0.56
24 0.52
25 0.47
26 0.45
27 0.46
28 0.37
29 0.39
30 0.31
31 0.31
32 0.27
33 0.26
34 0.24
35 0.17
36 0.16
37 0.11
38 0.11
39 0.11
40 0.12
41 0.13
42 0.12
43 0.12
44 0.12
45 0.14
46 0.16
47 0.17
48 0.18
49 0.2
50 0.19
51 0.2
52 0.2
53 0.18
54 0.16
55 0.15
56 0.14
57 0.12
58 0.16
59 0.17
60 0.16
61 0.21
62 0.28
63 0.34
64 0.38
65 0.45
66 0.47
67 0.55
68 0.57
69 0.57
70 0.55
71 0.57
72 0.57
73 0.58
74 0.59
75 0.59
76 0.59
77 0.58