Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397S8W8

Protein Details
Accession A0A397S8W8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
89-108LEIWNQKKNKHSNQPFFFCKHydrophilic
NLS Segment(s)
Subcellular Location(s) E.R. 9, golg 8, plas 4, mito 2, extr 2
Family & Domain DBs
Amino Acid Sequences MGRENKMFLMFFLSFLEVLYAFSSILELETVLFAFELVCKIRNDKFFILGFHFGYERSDFFLISAWKSGKFEVAEYLALEIQDWKHSTLEIWNQKKNKHSNQPFFFCKFAPGLGKLKPLKIQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.15
4 0.09
5 0.09
6 0.09
7 0.08
8 0.06
9 0.06
10 0.07
11 0.05
12 0.06
13 0.05
14 0.04
15 0.04
16 0.04
17 0.05
18 0.04
19 0.04
20 0.04
21 0.04
22 0.04
23 0.06
24 0.06
25 0.09
26 0.1
27 0.13
28 0.18
29 0.22
30 0.26
31 0.26
32 0.29
33 0.27
34 0.28
35 0.28
36 0.26
37 0.22
38 0.18
39 0.17
40 0.13
41 0.14
42 0.13
43 0.1
44 0.1
45 0.1
46 0.09
47 0.09
48 0.11
49 0.11
50 0.1
51 0.12
52 0.1
53 0.11
54 0.12
55 0.12
56 0.12
57 0.12
58 0.12
59 0.11
60 0.12
61 0.12
62 0.11
63 0.12
64 0.09
65 0.09
66 0.08
67 0.08
68 0.07
69 0.09
70 0.1
71 0.11
72 0.11
73 0.11
74 0.12
75 0.15
76 0.24
77 0.31
78 0.36
79 0.42
80 0.46
81 0.5
82 0.58
83 0.63
84 0.64
85 0.65
86 0.7
87 0.74
88 0.78
89 0.82
90 0.8
91 0.74
92 0.66
93 0.55
94 0.48
95 0.38
96 0.33
97 0.3
98 0.28
99 0.3
100 0.31
101 0.39
102 0.39
103 0.42