Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397T9D9

Protein Details
Accession A0A397T9D9    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
92-116DVSTLKKTSKKMNKKLKIAFAKAKFHydrophilic
NLS Segment(s)
PositionSequence
100-108SKKMNKKLK
Subcellular Location(s) extr 17, E.R. 6, plas 2
Family & Domain DBs
Amino Acid Sequences MKFLSILTIFLVFVIVIVHAAPAAEKIGSNLKTFAIRRNGVYSRLLKKIDEVNKEYDEHIADFNKNLPIAAAANNLPVPAFLKEWNDKYTEDVSTLKKTSKKMNKKLKIAFAKAKFY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.04
4 0.04
5 0.04
6 0.04
7 0.04
8 0.04
9 0.04
10 0.05
11 0.05
12 0.05
13 0.07
14 0.14
15 0.16
16 0.17
17 0.17
18 0.17
19 0.23
20 0.24
21 0.29
22 0.29
23 0.29
24 0.3
25 0.36
26 0.36
27 0.34
28 0.38
29 0.37
30 0.34
31 0.38
32 0.37
33 0.31
34 0.32
35 0.37
36 0.39
37 0.38
38 0.36
39 0.35
40 0.35
41 0.36
42 0.34
43 0.27
44 0.21
45 0.16
46 0.15
47 0.12
48 0.1
49 0.1
50 0.11
51 0.11
52 0.1
53 0.09
54 0.08
55 0.08
56 0.08
57 0.09
58 0.09
59 0.08
60 0.09
61 0.09
62 0.09
63 0.08
64 0.07
65 0.08
66 0.08
67 0.09
68 0.1
69 0.15
70 0.2
71 0.23
72 0.25
73 0.25
74 0.24
75 0.27
76 0.28
77 0.23
78 0.21
79 0.22
80 0.24
81 0.27
82 0.28
83 0.3
84 0.32
85 0.35
86 0.43
87 0.51
88 0.58
89 0.64
90 0.73
91 0.78
92 0.83
93 0.88
94 0.88
95 0.87
96 0.84
97 0.84