Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397T2T8

Protein Details
Accession A0A397T2T8   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
30-51SDNINNKTKKNKRSHIKAELSDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 13.833, cyto 3.5, cyto_pero 3.166
Family & Domain DBs
Amino Acid Sequences MGGVPSNMLKYLKEECSNISEELCNILYDSDNINNKTKKNKRSHIKAELSDDDDVTGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.27
3 0.29
4 0.32
5 0.28
6 0.24
7 0.19
8 0.16
9 0.17
10 0.15
11 0.11
12 0.09
13 0.08
14 0.07
15 0.08
16 0.09
17 0.11
18 0.14
19 0.16
20 0.22
21 0.25
22 0.27
23 0.37
24 0.44
25 0.5
26 0.57
27 0.64
28 0.69
29 0.77
30 0.85
31 0.85
32 0.85
33 0.8
34 0.77
35 0.72
36 0.65
37 0.56
38 0.46