Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397T893

Protein Details
Accession A0A397T893    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
96-133HKLAEPEKTARKQRKERKNRAKRFRGTKKTKATTKKEKBasic
NLS Segment(s)
PositionSequence
89-133PRYRLVRHKLAEPEKTARKQRKERKNRAKRFRGTKKTKATTKKEK
Subcellular Location(s) mito 22, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADSGTATIRTRQFLTNRLLHRRQFVLDILHPGRANVSKDEIREKLATMYKADKDTIFVFGFRTNFGGGRSTGFGLIYDDLEHAKKFEPRYRLVRHKLAEPEKTARKQRKERKNRAKRFRGTKKTKATTKKEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.42
3 0.44
4 0.49
5 0.55
6 0.6
7 0.57
8 0.58
9 0.55
10 0.5
11 0.45
12 0.39
13 0.36
14 0.31
15 0.35
16 0.31
17 0.32
18 0.3
19 0.27
20 0.27
21 0.25
22 0.25
23 0.19
24 0.24
25 0.23
26 0.25
27 0.3
28 0.28
29 0.28
30 0.27
31 0.25
32 0.25
33 0.26
34 0.26
35 0.22
36 0.26
37 0.25
38 0.25
39 0.26
40 0.21
41 0.19
42 0.18
43 0.2
44 0.16
45 0.14
46 0.13
47 0.14
48 0.14
49 0.12
50 0.13
51 0.09
52 0.09
53 0.1
54 0.1
55 0.09
56 0.09
57 0.1
58 0.09
59 0.09
60 0.09
61 0.08
62 0.08
63 0.08
64 0.07
65 0.06
66 0.06
67 0.07
68 0.08
69 0.08
70 0.08
71 0.09
72 0.13
73 0.17
74 0.22
75 0.27
76 0.32
77 0.4
78 0.48
79 0.56
80 0.6
81 0.64
82 0.6
83 0.61
84 0.65
85 0.63
86 0.59
87 0.55
88 0.56
89 0.56
90 0.61
91 0.65
92 0.65
93 0.69
94 0.74
95 0.8
96 0.83
97 0.86
98 0.9
99 0.92
100 0.94
101 0.95
102 0.95
103 0.95
104 0.94
105 0.94
106 0.94
107 0.93
108 0.92
109 0.91
110 0.91
111 0.9
112 0.9
113 0.89