Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397SS60

Protein Details
Accession A0A397SS60    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
12-45GKVKSQTPKVEKQEKKKKKTGRAKKRILYNRRFVBasic
NLS Segment(s)
PositionSequence
11-38AGKVKSQTPKVEKQEKKKKKTGRAKKRI
Subcellular Location(s) nucl 13, mito 11, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQTPKVEKQEKKKKKTGRAKKRILYNRRFVNVTNMIGGKRRMNPAPTTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.46
4 0.49
5 0.53
6 0.62
7 0.65
8 0.71
9 0.72
10 0.75
11 0.79
12 0.8
13 0.82
14 0.81
15 0.81
16 0.81
17 0.85
18 0.85
19 0.85
20 0.86
21 0.87
22 0.84
23 0.85
24 0.85
25 0.84
26 0.81
27 0.78
28 0.75
29 0.69
30 0.64
31 0.55
32 0.53
33 0.48
34 0.41
35 0.35
36 0.29
37 0.27
38 0.29
39 0.31
40 0.28
41 0.28
42 0.33
43 0.35
44 0.39