Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TD52

Protein Details
Accession A0A397TD52    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
11-34TFYYRNVPRKHFRKQPYPMRAPDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito_nucl 11.833, mito 9.5, cyto_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR007526  SWIRM  
IPR036388  WH-like_DNA-bd_sf  
Pfam View protein in Pfam  
PF04433  SWIRM  
Amino Acid Sequences MTTKSQKSTTTFYYRNVPRKHFRKQPYPMRAPDSSGDGFVCRINVYEIYAKNPGLLLNNDSQDSNTQNFNSLNKLVKDIDQLPIDHQILNCKNPRIIWDKTKSMDVSREDGYNLLHIKEKSLCSKLRLTPSTYLKAKYNILKAAQQFKLEGKDFKKSDAQKSGIDFNVNKASVLWNFFNQLKWV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.63
3 0.65
4 0.65
5 0.66
6 0.72
7 0.78
8 0.78
9 0.79
10 0.8
11 0.83
12 0.85
13 0.85
14 0.86
15 0.82
16 0.78
17 0.7
18 0.63
19 0.54
20 0.49
21 0.39
22 0.31
23 0.26
24 0.2
25 0.19
26 0.16
27 0.15
28 0.09
29 0.09
30 0.1
31 0.1
32 0.12
33 0.16
34 0.17
35 0.2
36 0.22
37 0.21
38 0.2
39 0.2
40 0.18
41 0.15
42 0.16
43 0.15
44 0.16
45 0.17
46 0.17
47 0.17
48 0.17
49 0.16
50 0.17
51 0.16
52 0.14
53 0.13
54 0.16
55 0.17
56 0.17
57 0.18
58 0.18
59 0.2
60 0.18
61 0.21
62 0.19
63 0.19
64 0.21
65 0.2
66 0.21
67 0.18
68 0.18
69 0.17
70 0.2
71 0.19
72 0.17
73 0.15
74 0.19
75 0.19
76 0.23
77 0.24
78 0.22
79 0.22
80 0.21
81 0.25
82 0.24
83 0.26
84 0.3
85 0.33
86 0.36
87 0.36
88 0.39
89 0.36
90 0.32
91 0.33
92 0.28
93 0.26
94 0.23
95 0.22
96 0.19
97 0.19
98 0.17
99 0.15
100 0.14
101 0.11
102 0.14
103 0.13
104 0.15
105 0.18
106 0.21
107 0.23
108 0.27
109 0.28
110 0.28
111 0.35
112 0.38
113 0.43
114 0.43
115 0.42
116 0.45
117 0.48
118 0.52
119 0.49
120 0.46
121 0.4
122 0.41
123 0.42
124 0.41
125 0.4
126 0.37
127 0.37
128 0.39
129 0.41
130 0.46
131 0.43
132 0.39
133 0.35
134 0.34
135 0.38
136 0.36
137 0.37
138 0.32
139 0.39
140 0.39
141 0.41
142 0.47
143 0.46
144 0.52
145 0.54
146 0.54
147 0.49
148 0.52
149 0.54
150 0.47
151 0.47
152 0.38
153 0.35
154 0.39
155 0.36
156 0.32
157 0.27
158 0.29
159 0.26
160 0.31
161 0.28
162 0.22
163 0.26
164 0.28