Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TB66

Protein Details
Accession A0A397TB66    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
114-135IGKSSQSQKNHEKKRSQKGKKGBasic
NLS Segment(s)
PositionSequence
125-136HEKKRSQKGKKG
Subcellular Location(s) nucl 16.5, cyto_nucl 10.833, cyto 4, cyto_pero 3.333, mito 3
Family & Domain DBs
Amino Acid Sequences MHINARLSKLKYLLRDVLDPAAEEIQHAKKQRERIYDDDTYFTYSKPSENTSEWTYDAEKIRNKATDVKMLKYGVNDNNNKMTQYDDMSLTDLNLDYLLNSAXMNLIWPEDLDEIGKSSQSQKNHEKKRSQKGKKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.42
3 0.4
4 0.37
5 0.33
6 0.29
7 0.24
8 0.19
9 0.16
10 0.14
11 0.16
12 0.18
13 0.22
14 0.25
15 0.29
16 0.32
17 0.41
18 0.48
19 0.52
20 0.53
21 0.55
22 0.58
23 0.59
24 0.56
25 0.49
26 0.43
27 0.39
28 0.33
29 0.27
30 0.22
31 0.16
32 0.16
33 0.16
34 0.18
35 0.17
36 0.19
37 0.23
38 0.23
39 0.24
40 0.23
41 0.23
42 0.21
43 0.21
44 0.21
45 0.21
46 0.22
47 0.22
48 0.24
49 0.24
50 0.25
51 0.28
52 0.28
53 0.33
54 0.32
55 0.31
56 0.32
57 0.31
58 0.31
59 0.24
60 0.27
61 0.23
62 0.29
63 0.3
64 0.29
65 0.33
66 0.32
67 0.31
68 0.27
69 0.23
70 0.17
71 0.18
72 0.17
73 0.13
74 0.13
75 0.14
76 0.14
77 0.12
78 0.11
79 0.08
80 0.07
81 0.06
82 0.05
83 0.04
84 0.05
85 0.05
86 0.05
87 0.04
88 0.05
89 0.05
90 0.06
91 0.06
92 0.06
93 0.06
94 0.06
95 0.08
96 0.08
97 0.08
98 0.08
99 0.08
100 0.1
101 0.1
102 0.1
103 0.1
104 0.17
105 0.22
106 0.26
107 0.33
108 0.42
109 0.53
110 0.63
111 0.71
112 0.74
113 0.8
114 0.86
115 0.9