Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397STU0

Protein Details
Accession A0A397STU0    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
8-39RKSTIFLKRKKLSSVKKRRDIPRDPIRWKPLEBasic
NLS Segment(s)
PositionSequence
15-31KRKKLSSVKKRRDIPRD
Subcellular Location(s) nucl 16.5, mito_nucl 13.166, cyto_nucl 9.833, mito 8.5
Family & Domain DBs
Amino Acid Sequences MRIYLNDRKSTIFLKRKKLSSVKKRRDIPRDPIRWKPLELIAILNYLNNNFDLWSSNRLGACNNAKEATNIARDGKAIYSKVYSMIKAMDDYNKTGKKSTANTIIWDNTKIHELVKDLCKKIKENKGGETSDDESMSMDTDQITTEASTSRTYDVPRQVPLSVETVDSLYNEKLQYISQLRSTLIETIENANSTLERSNIQTNYSTEDVNKRCNDKTQLAKKLRSELMEMIKDAKNKYEQLRDLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.64
3 0.67
4 0.73
5 0.77
6 0.78
7 0.79
8 0.83
9 0.83
10 0.85
11 0.89
12 0.9
13 0.89
14 0.87
15 0.86
16 0.86
17 0.85
18 0.82
19 0.82
20 0.8
21 0.73
22 0.66
23 0.6
24 0.53
25 0.46
26 0.41
27 0.34
28 0.26
29 0.25
30 0.23
31 0.19
32 0.15
33 0.12
34 0.12
35 0.1
36 0.09
37 0.07
38 0.08
39 0.11
40 0.12
41 0.17
42 0.18
43 0.2
44 0.21
45 0.21
46 0.22
47 0.25
48 0.29
49 0.27
50 0.27
51 0.25
52 0.25
53 0.25
54 0.27
55 0.24
56 0.2
57 0.2
58 0.19
59 0.18
60 0.18
61 0.19
62 0.18
63 0.17
64 0.15
65 0.14
66 0.14
67 0.14
68 0.17
69 0.18
70 0.16
71 0.14
72 0.14
73 0.13
74 0.13
75 0.14
76 0.15
77 0.15
78 0.18
79 0.24
80 0.26
81 0.27
82 0.27
83 0.28
84 0.28
85 0.3
86 0.33
87 0.35
88 0.33
89 0.34
90 0.35
91 0.35
92 0.31
93 0.3
94 0.24
95 0.16
96 0.16
97 0.15
98 0.12
99 0.11
100 0.11
101 0.14
102 0.21
103 0.26
104 0.26
105 0.28
106 0.3
107 0.32
108 0.39
109 0.44
110 0.45
111 0.42
112 0.47
113 0.5
114 0.48
115 0.46
116 0.41
117 0.35
118 0.27
119 0.24
120 0.18
121 0.12
122 0.12
123 0.11
124 0.08
125 0.05
126 0.05
127 0.05
128 0.05
129 0.05
130 0.05
131 0.04
132 0.05
133 0.06
134 0.07
135 0.08
136 0.08
137 0.1
138 0.11
139 0.13
140 0.18
141 0.24
142 0.25
143 0.26
144 0.28
145 0.26
146 0.26
147 0.26
148 0.23
149 0.17
150 0.15
151 0.13
152 0.12
153 0.11
154 0.11
155 0.11
156 0.09
157 0.1
158 0.1
159 0.1
160 0.1
161 0.1
162 0.15
163 0.17
164 0.19
165 0.19
166 0.21
167 0.21
168 0.21
169 0.23
170 0.19
171 0.16
172 0.15
173 0.13
174 0.16
175 0.16
176 0.15
177 0.15
178 0.13
179 0.12
180 0.13
181 0.12
182 0.1
183 0.1
184 0.12
185 0.19
186 0.19
187 0.21
188 0.23
189 0.23
190 0.27
191 0.28
192 0.25
193 0.22
194 0.3
195 0.31
196 0.36
197 0.4
198 0.39
199 0.4
200 0.47
201 0.51
202 0.51
203 0.58
204 0.61
205 0.66
206 0.7
207 0.74
208 0.71
209 0.73
210 0.69
211 0.6
212 0.54
213 0.51
214 0.51
215 0.47
216 0.44
217 0.4
218 0.39
219 0.41
220 0.38
221 0.37
222 0.34
223 0.37
224 0.43
225 0.48