Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SXM3

Protein Details
Accession A0A397SXM3    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
7-34KMESRVSRKYSGRKVKNKRNKNDTEDNDHydrophilic
NLS Segment(s)
PositionSequence
18-25GRKVKNKR
Subcellular Location(s) nucl 22, cyto_nucl 14.333, cyto_pero 2.332
Family & Domain DBs
Amino Acid Sequences MLFTYSKMESRVSRKYSGRKVKNKRNKNDTEDNDENNSNYDKSESEENDESEIDSNESESGDGNKNELGDSNKSESEENYYNENKEQPVFQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.61
3 0.68
4 0.72
5 0.76
6 0.77
7 0.83
8 0.87
9 0.91
10 0.92
11 0.91
12 0.91
13 0.89
14 0.86
15 0.86
16 0.79
17 0.78
18 0.72
19 0.64
20 0.57
21 0.49
22 0.41
23 0.32
24 0.28
25 0.18
26 0.14
27 0.12
28 0.09
29 0.1
30 0.15
31 0.13
32 0.17
33 0.18
34 0.18
35 0.18
36 0.18
37 0.16
38 0.13
39 0.13
40 0.08
41 0.07
42 0.07
43 0.06
44 0.06
45 0.06
46 0.05
47 0.08
48 0.11
49 0.12
50 0.12
51 0.13
52 0.13
53 0.13
54 0.15
55 0.16
56 0.15
57 0.19
58 0.22
59 0.22
60 0.23
61 0.24
62 0.22
63 0.26
64 0.27
65 0.26
66 0.28
67 0.3
68 0.31
69 0.33
70 0.35
71 0.3
72 0.27