Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397TLZ9

Protein Details
Accession A0A397TLZ9    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
36-57AAVSIKKQRQYRQYMNRRGGFNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 12.5, cyto 8, plas 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences MNIDPDEDPELTLMKAMGIAGFNSTKGKKVVGNDAAAVSIKKQRQYRQYMNRRGGFNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.06
5 0.05
6 0.05
7 0.07
8 0.07
9 0.08
10 0.11
11 0.11
12 0.13
13 0.13
14 0.14
15 0.14
16 0.16
17 0.23
18 0.23
19 0.24
20 0.22
21 0.22
22 0.21
23 0.19
24 0.17
25 0.11
26 0.14
27 0.16
28 0.22
29 0.28
30 0.35
31 0.44
32 0.54
33 0.63
34 0.68
35 0.77
36 0.81
37 0.84
38 0.83