Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397S840

Protein Details
Accession A0A397S840    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
54-73SRVCCDYYKKVKKVKRSPAIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, mito_nucl 13, mito 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027796  OTT_1508_deam-like  
Pfam View protein in Pfam  
PF14441  OTT_1508_deam  
Amino Acid Sequences MAYCSVKFNSRFEKLKKDITHNRDEPYIKSFRSFMRDFSIDVNNIKDVKRHVISRVCCDYYKKVKKVKRSPAILERFLRHLKKVGSYIGSLINITRCVCNEFHRDQIFNLELHKLHPNMTCQTISSWNSIIQKYFDNPKEFEDFRNACLDDIETKEKLIEIYHKPLATQLDNEIRQDVCLHAEMNILADIINWKDKCRVFIAKSKNCCYLCELITTSGWNPCKGNSLDSFDLDYEIHKGIDAIWN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.69
3 0.69
4 0.7
5 0.73
6 0.72
7 0.76
8 0.7
9 0.68
10 0.65
11 0.61
12 0.53
13 0.49
14 0.48
15 0.38
16 0.36
17 0.36
18 0.33
19 0.38
20 0.37
21 0.33
22 0.35
23 0.35
24 0.34
25 0.35
26 0.36
27 0.3
28 0.31
29 0.3
30 0.25
31 0.26
32 0.25
33 0.24
34 0.22
35 0.27
36 0.29
37 0.3
38 0.34
39 0.4
40 0.44
41 0.49
42 0.53
43 0.48
44 0.46
45 0.47
46 0.49
47 0.52
48 0.59
49 0.59
50 0.61
51 0.64
52 0.73
53 0.8
54 0.82
55 0.8
56 0.77
57 0.77
58 0.77
59 0.78
60 0.74
61 0.67
62 0.58
63 0.54
64 0.54
65 0.48
66 0.4
67 0.38
68 0.33
69 0.33
70 0.33
71 0.3
72 0.26
73 0.24
74 0.24
75 0.21
76 0.19
77 0.16
78 0.14
79 0.12
80 0.11
81 0.11
82 0.1
83 0.09
84 0.11
85 0.12
86 0.16
87 0.21
88 0.22
89 0.28
90 0.3
91 0.3
92 0.27
93 0.3
94 0.27
95 0.21
96 0.2
97 0.15
98 0.13
99 0.14
100 0.17
101 0.14
102 0.15
103 0.17
104 0.19
105 0.19
106 0.21
107 0.19
108 0.16
109 0.17
110 0.19
111 0.19
112 0.18
113 0.17
114 0.18
115 0.2
116 0.2
117 0.2
118 0.16
119 0.16
120 0.16
121 0.23
122 0.25
123 0.25
124 0.25
125 0.27
126 0.31
127 0.31
128 0.3
129 0.32
130 0.28
131 0.26
132 0.29
133 0.27
134 0.21
135 0.21
136 0.2
137 0.14
138 0.16
139 0.18
140 0.14
141 0.14
142 0.14
143 0.14
144 0.14
145 0.13
146 0.16
147 0.16
148 0.22
149 0.25
150 0.25
151 0.25
152 0.27
153 0.29
154 0.24
155 0.22
156 0.21
157 0.25
158 0.26
159 0.27
160 0.26
161 0.22
162 0.21
163 0.21
164 0.17
165 0.11
166 0.11
167 0.1
168 0.09
169 0.1
170 0.1
171 0.1
172 0.09
173 0.07
174 0.06
175 0.06
176 0.07
177 0.08
178 0.15
179 0.14
180 0.15
181 0.22
182 0.24
183 0.26
184 0.31
185 0.38
186 0.36
187 0.44
188 0.54
189 0.56
190 0.63
191 0.65
192 0.68
193 0.6
194 0.57
195 0.54
196 0.49
197 0.41
198 0.38
199 0.35
200 0.28
201 0.28
202 0.29
203 0.25
204 0.27
205 0.28
206 0.25
207 0.24
208 0.23
209 0.3
210 0.29
211 0.33
212 0.3
213 0.36
214 0.36
215 0.37
216 0.38
217 0.31
218 0.31
219 0.26
220 0.22
221 0.17
222 0.16
223 0.14
224 0.12
225 0.11