Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SCB0

Protein Details
Accession A0A397SCB0   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-33HQEMQKRGKKCSTCKRLKKKKCVVDHSCETHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MKVHQEMQKRGKKCSTCKRLKKKKCVVDHSCETYAREDEDKEEEEEEVLNSSYQSTSTIPQPFST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.72
3 0.75
4 0.83
5 0.88
6 0.91
7 0.93
8 0.94
9 0.93
10 0.91
11 0.9
12 0.89
13 0.85
14 0.82
15 0.77
16 0.72
17 0.64
18 0.55
19 0.46
20 0.37
21 0.31
22 0.24
23 0.19
24 0.14
25 0.13
26 0.16
27 0.16
28 0.15
29 0.15
30 0.14
31 0.13
32 0.13
33 0.11
34 0.09
35 0.08
36 0.07
37 0.07
38 0.08
39 0.07
40 0.07
41 0.09
42 0.1
43 0.12
44 0.18
45 0.24