Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A2QZA9

Protein Details
Accession A2QZA9    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
76-102RESKSRPQTVKRLTKRCRRAQEQLTLIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, mito 5
Family & Domain DBs
Amino Acid Sequences MYLKAENRQRSDTPASSVEPGKRDIDPRLLKANSISITKTSPCHLNTQLPHPSSTEVPIRRSVRGTAKATDLAPVRESKSRPQTVKRLTKRCRRAQEQLTLILGQSEQLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.4
3 0.37
4 0.4
5 0.37
6 0.31
7 0.32
8 0.29
9 0.28
10 0.29
11 0.29
12 0.35
13 0.35
14 0.36
15 0.42
16 0.39
17 0.38
18 0.36
19 0.37
20 0.29
21 0.26
22 0.24
23 0.17
24 0.19
25 0.2
26 0.2
27 0.17
28 0.2
29 0.19
30 0.24
31 0.25
32 0.29
33 0.29
34 0.35
35 0.39
36 0.35
37 0.34
38 0.3
39 0.29
40 0.23
41 0.24
42 0.23
43 0.19
44 0.2
45 0.27
46 0.28
47 0.28
48 0.29
49 0.3
50 0.31
51 0.36
52 0.37
53 0.32
54 0.32
55 0.33
56 0.31
57 0.31
58 0.26
59 0.2
60 0.18
61 0.18
62 0.19
63 0.22
64 0.24
65 0.28
66 0.37
67 0.43
68 0.47
69 0.53
70 0.6
71 0.66
72 0.75
73 0.77
74 0.78
75 0.8
76 0.85
77 0.88
78 0.88
79 0.88
80 0.85
81 0.86
82 0.83
83 0.84
84 0.78
85 0.71
86 0.63
87 0.53
88 0.45
89 0.35
90 0.27