Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SEE2

Protein Details
Accession A0A397SEE2   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
86-114EVIRTKLKNYNQKKVRKKKTRIVDQPTESHydrophilic
NLS Segment(s)
PositionSequence
98-104KKVRKKK
Subcellular Location(s) nucl 14.5, cyto_nucl 10, cyto 4.5, mito 3, pero 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MAVIWVAIGTAIIIYITNKGMKTSKIMDDNNDKDICLKYSPIEMHKEELDRLIACYPDGLKQIKKVYLQEVLGIERRNIQDRRTAEVIRTKLKNYNQKKVRKKKTRIVDQPTESAQSVMAESSSKRLLDLNELCPPDITEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.06
3 0.08
4 0.1
5 0.11
6 0.14
7 0.16
8 0.17
9 0.22
10 0.25
11 0.29
12 0.35
13 0.36
14 0.4
15 0.47
16 0.48
17 0.49
18 0.44
19 0.38
20 0.32
21 0.32
22 0.28
23 0.2
24 0.18
25 0.14
26 0.18
27 0.21
28 0.23
29 0.27
30 0.25
31 0.27
32 0.28
33 0.28
34 0.23
35 0.22
36 0.2
37 0.15
38 0.15
39 0.13
40 0.11
41 0.09
42 0.1
43 0.09
44 0.1
45 0.13
46 0.14
47 0.14
48 0.18
49 0.22
50 0.25
51 0.26
52 0.25
53 0.25
54 0.26
55 0.25
56 0.23
57 0.2
58 0.18
59 0.19
60 0.17
61 0.15
62 0.15
63 0.16
64 0.21
65 0.21
66 0.21
67 0.25
68 0.26
69 0.32
70 0.32
71 0.31
72 0.28
73 0.33
74 0.36
75 0.35
76 0.36
77 0.32
78 0.35
79 0.42
80 0.5
81 0.5
82 0.57
83 0.59
84 0.68
85 0.77
86 0.81
87 0.85
88 0.86
89 0.88
90 0.87
91 0.89
92 0.9
93 0.89
94 0.87
95 0.86
96 0.79
97 0.74
98 0.66
99 0.59
100 0.48
101 0.37
102 0.28
103 0.19
104 0.16
105 0.11
106 0.1
107 0.08
108 0.08
109 0.12
110 0.14
111 0.14
112 0.14
113 0.16
114 0.17
115 0.26
116 0.3
117 0.31
118 0.36
119 0.37
120 0.37
121 0.35