Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SPF6

Protein Details
Accession A0A397SPF6    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
80-103SLIFIRYLHKKRNNNKKTKASVVSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 17, nucl 4, cyto 3, mito 1, golg 1, vacu 1
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MENSGATEGELFPGETDVIPYESINNKNNFAGESGNPDEGNGGENNGNYYNKSDNESNDKSGAKDLGYIISFVILFIILSLIFIRYLHKKRNNNKKTKASVVSVAPISPVAPVVIRNERIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.09
4 0.09
5 0.1
6 0.1
7 0.1
8 0.13
9 0.18
10 0.22
11 0.27
12 0.28
13 0.29
14 0.29
15 0.3
16 0.26
17 0.22
18 0.2
19 0.15
20 0.19
21 0.19
22 0.2
23 0.19
24 0.18
25 0.17
26 0.15
27 0.16
28 0.09
29 0.08
30 0.08
31 0.08
32 0.1
33 0.11
34 0.12
35 0.1
36 0.12
37 0.13
38 0.13
39 0.17
40 0.17
41 0.17
42 0.25
43 0.27
44 0.26
45 0.26
46 0.26
47 0.23
48 0.22
49 0.21
50 0.12
51 0.11
52 0.1
53 0.09
54 0.09
55 0.09
56 0.08
57 0.07
58 0.07
59 0.06
60 0.06
61 0.03
62 0.03
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.04
69 0.04
70 0.04
71 0.07
72 0.15
73 0.21
74 0.3
75 0.4
76 0.49
77 0.59
78 0.7
79 0.78
80 0.81
81 0.86
82 0.87
83 0.85
84 0.84
85 0.79
86 0.72
87 0.66
88 0.58
89 0.52
90 0.43
91 0.35
92 0.27
93 0.22
94 0.18
95 0.13
96 0.11
97 0.07
98 0.07
99 0.09
100 0.15
101 0.22