Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TIY0

Protein Details
Accession A0A397TIY0    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
52-106CPNNRTCLQSKPKRRWIKKKQLMRDIINWEKSEKKRVERKKYLKHKTKRSELILAHydrophilic
NLS Segment(s)
PositionSequence
62-101KPKRRWIKKKQLMRDIINWEKSEKKRVERKKYLKHKTKRS
Subcellular Location(s) nucl 14, mito 10, cyto 2
Family & Domain DBs
Amino Acid Sequences MKPIVNEEDAGKVKIILPVMFRSPTIVTKYKELVTAVDSTGYWKTINIDQYCPNNRTCLQSKPKRRWIKKKQLMRDIINWEKSEKKRVERKKYLKHKTKRSELILAIVNKKIKLKIYTIRKELNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.16
4 0.17
5 0.19
6 0.22
7 0.22
8 0.2
9 0.21
10 0.21
11 0.23
12 0.27
13 0.3
14 0.28
15 0.32
16 0.35
17 0.33
18 0.33
19 0.3
20 0.24
21 0.2
22 0.2
23 0.16
24 0.14
25 0.12
26 0.12
27 0.12
28 0.12
29 0.1
30 0.09
31 0.11
32 0.13
33 0.2
34 0.2
35 0.22
36 0.25
37 0.32
38 0.37
39 0.36
40 0.33
41 0.3
42 0.29
43 0.32
44 0.31
45 0.33
46 0.39
47 0.46
48 0.55
49 0.61
50 0.7
51 0.75
52 0.82
53 0.84
54 0.85
55 0.88
56 0.87
57 0.88
58 0.87
59 0.86
60 0.83
61 0.76
62 0.71
63 0.68
64 0.64
65 0.58
66 0.5
67 0.42
68 0.43
69 0.42
70 0.44
71 0.41
72 0.44
73 0.51
74 0.61
75 0.7
76 0.73
77 0.81
78 0.83
79 0.89
80 0.92
81 0.92
82 0.92
83 0.92
84 0.91
85 0.9
86 0.88
87 0.83
88 0.79
89 0.7
90 0.64
91 0.6
92 0.54
93 0.47
94 0.43
95 0.39
96 0.34
97 0.36
98 0.34
99 0.34
100 0.33
101 0.37
102 0.42
103 0.51
104 0.59
105 0.63