Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TCH7

Protein Details
Accession A0A397TCH7    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
9-42YHLKRAREIQAQKSKKKKNNKRRKINEVINKIDEHydrophilic
NLS Segment(s)
PositionSequence
13-32RAREIQAQKSKKKKNNKRRK
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MPHILKQAYHLKRAREIQAQKSKKKKNNKRRKINEVINKIDESKLDNTLELITKLPELSKEQFSLNEGKLISPYFQNKAQVKRLFNKLDLKTHANMSLSLKQSKLQLASSKIEVKNLAAGLEKIRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.58
3 0.6
4 0.62
5 0.68
6 0.73
7 0.74
8 0.79
9 0.82
10 0.81
11 0.86
12 0.86
13 0.87
14 0.89
15 0.91
16 0.92
17 0.92
18 0.94
19 0.93
20 0.91
21 0.9
22 0.87
23 0.82
24 0.73
25 0.64
26 0.55
27 0.45
28 0.35
29 0.29
30 0.23
31 0.2
32 0.17
33 0.16
34 0.15
35 0.15
36 0.16
37 0.12
38 0.11
39 0.08
40 0.08
41 0.08
42 0.08
43 0.08
44 0.11
45 0.13
46 0.14
47 0.15
48 0.16
49 0.16
50 0.17
51 0.2
52 0.16
53 0.16
54 0.14
55 0.13
56 0.13
57 0.13
58 0.12
59 0.12
60 0.14
61 0.14
62 0.16
63 0.24
64 0.27
65 0.33
66 0.41
67 0.44
68 0.46
69 0.5
70 0.56
71 0.52
72 0.52
73 0.56
74 0.5
75 0.51
76 0.51
77 0.49
78 0.42
79 0.41
80 0.39
81 0.31
82 0.29
83 0.28
84 0.3
85 0.3
86 0.3
87 0.28
88 0.27
89 0.3
90 0.31
91 0.28
92 0.26
93 0.28
94 0.31
95 0.34
96 0.37
97 0.42
98 0.39
99 0.4
100 0.36
101 0.31
102 0.31
103 0.28
104 0.25
105 0.18
106 0.19