Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4QV55

Protein Details
Accession C4QV55   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
111-161IVDLKEIRRKREKAKKSKRKEEKKEKKKAKESKEKKEKKVKKVKKVQEGQEBasic
NLS Segment(s)
PositionSequence
116-155EIRRKREKAKKSKRKEEKKEKKKAKESKEKKEKKVKKVKK
Subcellular Location(s) nucl 13, cyto_nucl 11.333, mito_nucl 10.999, mito 7.5, cyto 6.5
Family & Domain DBs
KEGG ppa:PAS_chr1-3_0073  -  
Amino Acid Sequences MDSKRYLVSYGWKEGEALKKGGLKRPILVKQKRDTKGLGNDINDGEVWWEKLFDVQLKNLEVYNSDKVKFEQKEIKIDKSPLYSMFVQGEGLTGTIGVEEETVQATVRKQIVDLKEIRRKREKAKKSKRKEEKKEKKKAKESKEKKEKKVKKVKKVQEGQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.43
3 0.37
4 0.33
5 0.29
6 0.33
7 0.36
8 0.43
9 0.44
10 0.38
11 0.39
12 0.47
13 0.53
14 0.58
15 0.63
16 0.64
17 0.67
18 0.75
19 0.73
20 0.68
21 0.62
22 0.59
23 0.6
24 0.59
25 0.54
26 0.46
27 0.44
28 0.41
29 0.38
30 0.3
31 0.21
32 0.15
33 0.11
34 0.11
35 0.08
36 0.08
37 0.07
38 0.09
39 0.1
40 0.12
41 0.13
42 0.14
43 0.17
44 0.17
45 0.18
46 0.17
47 0.16
48 0.14
49 0.16
50 0.2
51 0.19
52 0.19
53 0.19
54 0.2
55 0.28
56 0.27
57 0.28
58 0.3
59 0.3
60 0.39
61 0.41
62 0.44
63 0.39
64 0.4
65 0.37
66 0.31
67 0.3
68 0.21
69 0.22
70 0.18
71 0.16
72 0.15
73 0.13
74 0.11
75 0.1
76 0.1
77 0.06
78 0.06
79 0.04
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.04
89 0.04
90 0.05
91 0.06
92 0.06
93 0.1
94 0.11
95 0.11
96 0.11
97 0.17
98 0.19
99 0.24
100 0.29
101 0.34
102 0.42
103 0.46
104 0.52
105 0.56
106 0.6
107 0.65
108 0.7
109 0.73
110 0.75
111 0.83
112 0.87
113 0.88
114 0.94
115 0.94
116 0.95
117 0.95
118 0.95
119 0.95
120 0.95
121 0.96
122 0.95
123 0.95
124 0.94
125 0.93
126 0.93
127 0.93
128 0.92
129 0.92
130 0.93
131 0.92
132 0.92
133 0.93
134 0.92
135 0.92
136 0.93
137 0.92
138 0.92
139 0.92
140 0.92
141 0.92