Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SB83

Protein Details
Accession A0A397SB83    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
72-98YGYDYKKEEKKDDKKKKEYYKRDALASBasic
NLS Segment(s)
PositionSequence
80-90KEEKKDDKKKK
Subcellular Location(s) cyto 10, nucl 9.5, mito_nucl 7.5, mito 4.5
Family & Domain DBs
Amino Acid Sequences MKFSTLACLTVLGVSALRVDTAPIAESNSNVELNNKRDXTPSQYYYDDDKKKEYXYYDYDHKKDDDKKKKEYGYGYDYKKEEKKDDKKKKEYYKRDALASPDEXKKDDDKKKEYYYY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.07
5 0.06
6 0.06
7 0.06
8 0.07
9 0.08
10 0.07
11 0.1
12 0.1
13 0.1
14 0.12
15 0.13
16 0.14
17 0.13
18 0.17
19 0.19
20 0.22
21 0.26
22 0.25
23 0.25
24 0.28
25 0.32
26 0.35
27 0.35
28 0.35
29 0.33
30 0.35
31 0.38
32 0.42
33 0.43
34 0.37
35 0.35
36 0.33
37 0.32
38 0.31
39 0.29
40 0.24
41 0.27
42 0.34
43 0.37
44 0.39
45 0.39
46 0.38
47 0.41
48 0.46
49 0.5
50 0.52
51 0.52
52 0.55
53 0.62
54 0.64
55 0.63
56 0.59
57 0.54
58 0.51
59 0.53
60 0.5
61 0.48
62 0.46
63 0.47
64 0.47
65 0.45
66 0.45
67 0.47
68 0.55
69 0.6
70 0.71
71 0.76
72 0.81
73 0.88
74 0.91
75 0.92
76 0.92
77 0.9
78 0.89
79 0.83
80 0.78
81 0.71
82 0.64
83 0.62
84 0.58
85 0.53
86 0.47
87 0.45
88 0.41
89 0.44
90 0.49
91 0.5
92 0.53
93 0.55
94 0.58