Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TPL1

Protein Details
Accession A0A397TPL1    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
100-129PQNSNYTKKNSRKERDRKGRKIQENTQKKQHydrophilic
NLS Segment(s)
PositionSequence
107-121KKNSRKERDRKGRKI
Subcellular Location(s) nucl 23, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MSNVHILKDIKDRGYQLGSTYEQELEKKLRTAIDFNSEIINFNEKLQAENLEYSERKEDIENKISQLNASSVKLVSKKNNKVDPPSSPMNDSSQKLSGIPQNSNYTKKNSRKERDRKGRKIQENTQKKQSKWSWMELKNGTISALCASLIIKKPLKVTQKLFESNRKVPGTDICKENKHPEINEQEIPKCYIDLMKRC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.36
3 0.3
4 0.3
5 0.29
6 0.27
7 0.27
8 0.25
9 0.22
10 0.23
11 0.25
12 0.24
13 0.25
14 0.24
15 0.25
16 0.26
17 0.27
18 0.3
19 0.29
20 0.32
21 0.3
22 0.29
23 0.3
24 0.27
25 0.25
26 0.23
27 0.24
28 0.17
29 0.16
30 0.2
31 0.17
32 0.18
33 0.17
34 0.18
35 0.16
36 0.17
37 0.18
38 0.18
39 0.19
40 0.19
41 0.21
42 0.19
43 0.18
44 0.19
45 0.23
46 0.25
47 0.31
48 0.31
49 0.29
50 0.3
51 0.3
52 0.27
53 0.23
54 0.19
55 0.14
56 0.14
57 0.13
58 0.12
59 0.14
60 0.18
61 0.2
62 0.26
63 0.34
64 0.41
65 0.48
66 0.55
67 0.55
68 0.58
69 0.59
70 0.54
71 0.5
72 0.47
73 0.4
74 0.35
75 0.33
76 0.31
77 0.31
78 0.27
79 0.24
80 0.21
81 0.2
82 0.18
83 0.19
84 0.18
85 0.17
86 0.17
87 0.18
88 0.22
89 0.25
90 0.29
91 0.29
92 0.31
93 0.38
94 0.45
95 0.51
96 0.56
97 0.63
98 0.7
99 0.78
100 0.83
101 0.86
102 0.89
103 0.89
104 0.9
105 0.91
106 0.89
107 0.87
108 0.85
109 0.84
110 0.84
111 0.79
112 0.78
113 0.74
114 0.66
115 0.67
116 0.62
117 0.62
118 0.56
119 0.59
120 0.59
121 0.56
122 0.63
123 0.55
124 0.52
125 0.43
126 0.39
127 0.31
128 0.21
129 0.18
130 0.11
131 0.1
132 0.07
133 0.06
134 0.06
135 0.12
136 0.15
137 0.2
138 0.22
139 0.23
140 0.27
141 0.34
142 0.42
143 0.44
144 0.46
145 0.49
146 0.54
147 0.6
148 0.62
149 0.65
150 0.65
151 0.63
152 0.66
153 0.59
154 0.52
155 0.46
156 0.49
157 0.46
158 0.43
159 0.43
160 0.4
161 0.44
162 0.48
163 0.54
164 0.53
165 0.53
166 0.5
167 0.53
168 0.56
169 0.56
170 0.57
171 0.54
172 0.5
173 0.47
174 0.47
175 0.4
176 0.31
177 0.26
178 0.27