Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SRN0

Protein Details
Accession A0A397SRN0    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
145-173NRWTEYDPPVKKNRRRSQKKMSSFCPYNTHydrophilic
NLS Segment(s)
PositionSequence
157-160NRRR
Subcellular Location(s) nucl 26, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MAQQSKKTPSPIPPKNMEQIRDSYENDNPFIGPPTPHKSDKYRSARINRLETIVGKVTDTVGTVADSVGQLSDRMGRMSLNEQSQKPFYCSNCEQEGHKKNNCHNLNPVAKSNFTRYYPQLPSMQSQYTPPDSDNEEDGYNEENNRWTEYDPPVKKNRRRSQKKMSSFCPYNT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.71
3 0.71
4 0.64
5 0.57
6 0.52
7 0.51
8 0.48
9 0.45
10 0.4
11 0.39
12 0.39
13 0.36
14 0.32
15 0.26
16 0.22
17 0.23
18 0.2
19 0.17
20 0.2
21 0.26
22 0.31
23 0.34
24 0.37
25 0.41
26 0.48
27 0.56
28 0.59
29 0.61
30 0.64
31 0.7
32 0.74
33 0.74
34 0.73
35 0.63
36 0.57
37 0.5
38 0.42
39 0.37
40 0.31
41 0.24
42 0.18
43 0.16
44 0.14
45 0.13
46 0.12
47 0.09
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.05
54 0.05
55 0.04
56 0.04
57 0.04
58 0.04
59 0.07
60 0.07
61 0.07
62 0.07
63 0.07
64 0.09
65 0.11
66 0.14
67 0.16
68 0.19
69 0.2
70 0.22
71 0.24
72 0.23
73 0.23
74 0.23
75 0.2
76 0.23
77 0.25
78 0.27
79 0.28
80 0.29
81 0.29
82 0.35
83 0.42
84 0.42
85 0.44
86 0.44
87 0.45
88 0.55
89 0.55
90 0.48
91 0.45
92 0.47
93 0.49
94 0.47
95 0.47
96 0.39
97 0.38
98 0.37
99 0.37
100 0.33
101 0.29
102 0.31
103 0.3
104 0.35
105 0.36
106 0.37
107 0.36
108 0.34
109 0.34
110 0.34
111 0.32
112 0.25
113 0.25
114 0.26
115 0.25
116 0.25
117 0.22
118 0.21
119 0.22
120 0.23
121 0.23
122 0.21
123 0.18
124 0.17
125 0.17
126 0.17
127 0.16
128 0.15
129 0.14
130 0.16
131 0.17
132 0.19
133 0.19
134 0.18
135 0.21
136 0.28
137 0.38
138 0.39
139 0.45
140 0.53
141 0.63
142 0.7
143 0.76
144 0.79
145 0.8
146 0.86
147 0.88
148 0.89
149 0.9
150 0.93
151 0.91
152 0.87
153 0.86