Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397S566

Protein Details
Accession A0A397S566    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPPYYKTSKSIKNKRPKVENPWILFSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Amino Acid Sequences MPPYYKTSKSIKNKRPKVENPWILFSNTFYSILSEKTKIKRQDAMKLASIEWNKLTDLERIPWYRLFNEKKLLRKIEENSQLINSTSLSPELMKPSYDNPFIIEDFSIMSLINQPKAADLCLNPESQLIDENKNNVELGICSNQLFNDNREFNMFEYQPEVADLFLSPESQLIDENKNNVELGICSIREFDMVEYQPEAADLCLIPESKLIDESENGEFRICSNQLFNDIREFDMVEYQPETVDLCLNPLIDRNEDEGENIDQLLDDIIDYNMLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.9
3 0.89
4 0.88
5 0.88
6 0.87
7 0.81
8 0.78
9 0.7
10 0.62
11 0.53
12 0.45
13 0.38
14 0.3
15 0.25
16 0.19
17 0.19
18 0.18
19 0.21
20 0.23
21 0.22
22 0.27
23 0.34
24 0.42
25 0.46
26 0.5
27 0.55
28 0.57
29 0.63
30 0.63
31 0.61
32 0.58
33 0.53
34 0.49
35 0.48
36 0.43
37 0.36
38 0.29
39 0.25
40 0.2
41 0.2
42 0.21
43 0.19
44 0.2
45 0.22
46 0.27
47 0.28
48 0.31
49 0.32
50 0.33
51 0.31
52 0.38
53 0.4
54 0.38
55 0.45
56 0.48
57 0.53
58 0.58
59 0.6
60 0.54
61 0.55
62 0.54
63 0.54
64 0.58
65 0.52
66 0.45
67 0.42
68 0.39
69 0.33
70 0.29
71 0.2
72 0.13
73 0.11
74 0.1
75 0.09
76 0.09
77 0.1
78 0.13
79 0.13
80 0.13
81 0.13
82 0.17
83 0.21
84 0.21
85 0.2
86 0.18
87 0.2
88 0.19
89 0.19
90 0.15
91 0.11
92 0.09
93 0.09
94 0.08
95 0.05
96 0.05
97 0.1
98 0.11
99 0.11
100 0.11
101 0.11
102 0.12
103 0.13
104 0.13
105 0.09
106 0.08
107 0.13
108 0.14
109 0.14
110 0.13
111 0.13
112 0.13
113 0.12
114 0.15
115 0.12
116 0.14
117 0.14
118 0.16
119 0.16
120 0.16
121 0.15
122 0.11
123 0.1
124 0.07
125 0.09
126 0.09
127 0.09
128 0.09
129 0.09
130 0.09
131 0.12
132 0.13
133 0.12
134 0.17
135 0.17
136 0.17
137 0.19
138 0.19
139 0.17
140 0.21
141 0.19
142 0.13
143 0.14
144 0.14
145 0.12
146 0.12
147 0.11
148 0.06
149 0.06
150 0.06
151 0.06
152 0.06
153 0.06
154 0.05
155 0.06
156 0.06
157 0.06
158 0.08
159 0.09
160 0.13
161 0.14
162 0.15
163 0.15
164 0.15
165 0.15
166 0.13
167 0.11
168 0.07
169 0.09
170 0.1
171 0.1
172 0.1
173 0.1
174 0.11
175 0.11
176 0.11
177 0.09
178 0.12
179 0.13
180 0.14
181 0.14
182 0.14
183 0.13
184 0.13
185 0.12
186 0.06
187 0.06
188 0.05
189 0.05
190 0.07
191 0.07
192 0.08
193 0.09
194 0.1
195 0.1
196 0.12
197 0.12
198 0.12
199 0.12
200 0.15
201 0.18
202 0.18
203 0.17
204 0.16
205 0.15
206 0.15
207 0.2
208 0.18
209 0.15
210 0.16
211 0.17
212 0.24
213 0.26
214 0.26
215 0.26
216 0.27
217 0.26
218 0.25
219 0.24
220 0.18
221 0.21
222 0.2
223 0.16
224 0.16
225 0.15
226 0.15
227 0.14
228 0.14
229 0.09
230 0.12
231 0.09
232 0.11
233 0.12
234 0.13
235 0.13
236 0.17
237 0.19
238 0.18
239 0.21
240 0.22
241 0.24
242 0.23
243 0.24
244 0.22
245 0.21
246 0.2
247 0.17
248 0.13
249 0.11
250 0.11
251 0.1
252 0.07
253 0.05
254 0.06
255 0.06