Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397S523

Protein Details
Accession A0A397S523    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
4-29KENNKIMKLKNYLKKQKNTDKKTFYLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 10, mito 3, cyto 2.5, plas 2, pero 2
Family & Domain DBs
Amino Acid Sequences MNMKENNKIMKLKNYLKKQKNTDKKTFYLLKITNQVNQLLIHKRFIHLDYLILLLRIFQNMITLTIIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.74
3 0.77
4 0.81
5 0.83
6 0.85
7 0.86
8 0.85
9 0.84
10 0.8
11 0.73
12 0.71
13 0.67
14 0.58
15 0.55
16 0.48
17 0.42
18 0.42
19 0.41
20 0.37
21 0.33
22 0.31
23 0.24
24 0.23
25 0.23
26 0.23
27 0.23
28 0.23
29 0.22
30 0.23
31 0.24
32 0.24
33 0.24
34 0.17
35 0.17
36 0.14
37 0.16
38 0.15
39 0.13
40 0.12
41 0.09
42 0.09
43 0.09
44 0.09
45 0.07
46 0.09
47 0.1
48 0.11