Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397S316

Protein Details
Accession A0A397S316    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
82-104NNLIEKVDKERKKRPWNKRENFKBasic
NLS Segment(s)
PositionSequence
90-104KERKKRPWNKRENFK
Subcellular Location(s) nucl 14.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR004087  KH_dom  
IPR004088  KH_dom_type_1  
IPR036612  KH_dom_type_1_sf  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00013  KH_1  
PROSITE View protein in PROSITE  
PS50084  KH_TYPE_1  
Amino Acid Sequences MQRSGYTVTSTTVTSTVIPIPQHIEVGRIIGREGRNLKPIREKTGTLISVNTNTKPPQIEIKYNTSSPPSNEQINEAKNLLNNLIEKVDKERKKRPWNKRENFK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.13
4 0.14
5 0.14
6 0.14
7 0.17
8 0.16
9 0.18
10 0.16
11 0.16
12 0.13
13 0.15
14 0.16
15 0.12
16 0.12
17 0.15
18 0.15
19 0.19
20 0.24
21 0.23
22 0.3
23 0.32
24 0.34
25 0.4
26 0.42
27 0.44
28 0.43
29 0.41
30 0.36
31 0.42
32 0.4
33 0.31
34 0.29
35 0.23
36 0.24
37 0.24
38 0.21
39 0.16
40 0.15
41 0.16
42 0.16
43 0.16
44 0.2
45 0.22
46 0.27
47 0.29
48 0.35
49 0.36
50 0.36
51 0.36
52 0.31
53 0.29
54 0.26
55 0.29
56 0.25
57 0.25
58 0.25
59 0.28
60 0.3
61 0.3
62 0.3
63 0.24
64 0.23
65 0.21
66 0.22
67 0.19
68 0.15
69 0.15
70 0.14
71 0.16
72 0.15
73 0.15
74 0.22
75 0.31
76 0.36
77 0.43
78 0.51
79 0.59
80 0.7
81 0.8
82 0.83
83 0.85
84 0.89