Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E2LL99

Protein Details
Accession E2LL99    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
70-89RTSERPKFFRGKKPLPKVLGBasic
NLS Segment(s)
PositionSequence
75-94PKFFRGKKPLPKVLGHPKKG
Subcellular Location(s) mito 14, cyto 6.5, cyto_nucl 5.5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011008  Dimeric_a/b-barrel  
Gene Ontology GO:0016491  F:oxidoreductase activity  
GO:0051716  P:cellular response to stimulus  
GO:0042221  P:response to chemical  
KEGG mpr:MPER_07498  -  
Amino Acid Sequences MIPVHRVKSDKTKEYKEAAEKYYMGLVEDPRLHVKLTGSWETSVGDQDAFFHILEYENYGGYDNTTQLVRTSERPKFFRGKKPLPKVLGHPKKGAPPTNLGVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.69
3 0.66
4 0.63
5 0.56
6 0.52
7 0.45
8 0.4
9 0.37
10 0.3
11 0.22
12 0.18
13 0.16
14 0.16
15 0.16
16 0.17
17 0.17
18 0.18
19 0.17
20 0.16
21 0.16
22 0.16
23 0.21
24 0.22
25 0.21
26 0.21
27 0.21
28 0.2
29 0.2
30 0.17
31 0.11
32 0.08
33 0.06
34 0.07
35 0.08
36 0.08
37 0.07
38 0.07
39 0.06
40 0.07
41 0.07
42 0.08
43 0.07
44 0.06
45 0.06
46 0.07
47 0.07
48 0.07
49 0.08
50 0.06
51 0.07
52 0.07
53 0.07
54 0.07
55 0.1
56 0.11
57 0.16
58 0.24
59 0.29
60 0.36
61 0.38
62 0.43
63 0.51
64 0.57
65 0.61
66 0.64
67 0.69
68 0.73
69 0.8
70 0.83
71 0.79
72 0.75
73 0.74
74 0.75
75 0.74
76 0.68
77 0.64
78 0.59
79 0.62
80 0.67
81 0.65
82 0.57
83 0.54