Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397T156

Protein Details
Accession A0A397T156   
Localization Confidence High
Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MGRYARSRTHKGIRDQYRKYRTRNYAKDLHydrophilic
78-102ALNRHQRGKNHKKRVKLLKETPYTQHydrophilic
NLS Segment(s)
PositionSequence
84-92RGKNHKKRV
Subcellular Location(s) nucl 20.5, cyto_nucl 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences MGRYARSRTHKGIRDQYRKYRTRNYAKDLDQIQEDIKKVKENGGDETILKPQEWNEDLPGLGQFYCISCAKYFVDSEALNRHQRGKNHKKRVKLLKETPYTQAEAEAAVGYSTENSRERL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.84
4 0.84
5 0.84
6 0.81
7 0.81
8 0.8
9 0.81
10 0.81
11 0.78
12 0.76
13 0.72
14 0.72
15 0.64
16 0.55
17 0.45
18 0.38
19 0.32
20 0.27
21 0.25
22 0.2
23 0.19
24 0.2
25 0.2
26 0.23
27 0.25
28 0.23
29 0.26
30 0.26
31 0.26
32 0.23
33 0.24
34 0.23
35 0.19
36 0.17
37 0.13
38 0.11
39 0.15
40 0.15
41 0.15
42 0.13
43 0.13
44 0.13
45 0.13
46 0.12
47 0.08
48 0.07
49 0.06
50 0.05
51 0.05
52 0.08
53 0.08
54 0.09
55 0.08
56 0.11
57 0.12
58 0.13
59 0.13
60 0.11
61 0.14
62 0.13
63 0.15
64 0.19
65 0.23
66 0.24
67 0.25
68 0.32
69 0.32
70 0.38
71 0.47
72 0.53
73 0.59
74 0.68
75 0.72
76 0.73
77 0.79
78 0.85
79 0.84
80 0.83
81 0.82
82 0.8
83 0.83
84 0.77
85 0.72
86 0.64
87 0.55
88 0.45
89 0.37
90 0.27
91 0.2
92 0.17
93 0.12
94 0.09
95 0.07
96 0.07
97 0.06
98 0.07
99 0.08
100 0.11