Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A397SFD1

Protein Details
Accession A0A397SFD1    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
49-77GKSQEKQKLYHNKKNKIKKKFQMENKVLYHydrophilic
NLS Segment(s)
PositionSequence
61-68KKNKIKKK
Subcellular Location(s) nucl 22, cyto_nucl 13.833, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MGGKYNLMYGRQMKTLLNLEDKEITMTNRINELIEELPKIRNQTRENIGKSQEKQKLYHNKKNKIKKKFQMENKVLYYDVAKEKQWSEKLKKMEGTLLYT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.33
3 0.32
4 0.32
5 0.3
6 0.3
7 0.3
8 0.3
9 0.27
10 0.22
11 0.19
12 0.18
13 0.19
14 0.17
15 0.17
16 0.17
17 0.15
18 0.14
19 0.16
20 0.13
21 0.13
22 0.13
23 0.12
24 0.13
25 0.14
26 0.18
27 0.18
28 0.24
29 0.25
30 0.3
31 0.36
32 0.42
33 0.44
34 0.44
35 0.45
36 0.43
37 0.44
38 0.46
39 0.45
40 0.4
41 0.39
42 0.44
43 0.51
44 0.55
45 0.63
46 0.64
47 0.68
48 0.75
49 0.84
50 0.84
51 0.84
52 0.85
53 0.84
54 0.85
55 0.85
56 0.86
57 0.86
58 0.82
59 0.79
60 0.71
61 0.64
62 0.53
63 0.44
64 0.35
65 0.29
66 0.3
67 0.24
68 0.23
69 0.24
70 0.27
71 0.34
72 0.4
73 0.44
74 0.47
75 0.52
76 0.57
77 0.61
78 0.62
79 0.57
80 0.57