Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SEB5

Protein Details
Accession A0A397SEB5    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
6-30IITEHNKLKRGKKYVMKKVEVREEDHydrophilic
118-144EKMDKIKMKIVRRRRWKIKNINYIERLHydrophilic
NLS Segment(s)
PositionSequence
124-134KMKIVRRRRWK
Subcellular Location(s) nucl 20, mito_nucl 13.333, cyto_nucl 10.833, mito 5.5
Family & Domain DBs
Amino Acid Sequences MFVEDIITEHNKLKRGKKYVMKKVEVREEDIENMDIINRIILKIDNIWGRFKNIKNSIENELLEKYYNRHNIIQKYKIERKENNNKVILKWYKRLAAINNEKIIIESGEARKLYSIMEKMDKIKMKIVRRRRWKIKNINYIERLLEITEKKNIYWSLIENIEKEKDKIKVENSIRRSEIIDVNEIEELIPVNRYSLYWNRKLVNDQIRETVKKYNKLKYLGEWLILNINENLITKLEEKEINWEKMIEYINNYKGGGMVMTSDKDRRDRSCNLKNLIEQLPTYKVMTKRNNEIYNEKCPRCKKEAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.57
3 0.65
4 0.7
5 0.77
6 0.81
7 0.84
8 0.84
9 0.81
10 0.81
11 0.82
12 0.75
13 0.7
14 0.63
15 0.55
16 0.49
17 0.44
18 0.36
19 0.25
20 0.22
21 0.17
22 0.14
23 0.11
24 0.11
25 0.09
26 0.08
27 0.09
28 0.1
29 0.11
30 0.12
31 0.17
32 0.21
33 0.22
34 0.27
35 0.27
36 0.32
37 0.38
38 0.4
39 0.44
40 0.47
41 0.51
42 0.51
43 0.54
44 0.54
45 0.52
46 0.49
47 0.41
48 0.35
49 0.3
50 0.26
51 0.23
52 0.2
53 0.23
54 0.29
55 0.29
56 0.34
57 0.4
58 0.48
59 0.55
60 0.6
61 0.59
62 0.63
63 0.68
64 0.69
65 0.71
66 0.69
67 0.72
68 0.75
69 0.77
70 0.75
71 0.74
72 0.67
73 0.6
74 0.62
75 0.6
76 0.54
77 0.51
78 0.47
79 0.44
80 0.44
81 0.47
82 0.42
83 0.44
84 0.48
85 0.48
86 0.46
87 0.42
88 0.4
89 0.37
90 0.32
91 0.22
92 0.13
93 0.12
94 0.12
95 0.15
96 0.15
97 0.15
98 0.14
99 0.14
100 0.14
101 0.14
102 0.15
103 0.14
104 0.17
105 0.19
106 0.21
107 0.26
108 0.28
109 0.25
110 0.3
111 0.33
112 0.39
113 0.46
114 0.55
115 0.58
116 0.67
117 0.76
118 0.8
119 0.84
120 0.85
121 0.88
122 0.88
123 0.89
124 0.84
125 0.82
126 0.74
127 0.65
128 0.55
129 0.45
130 0.34
131 0.24
132 0.21
133 0.15
134 0.13
135 0.16
136 0.16
137 0.15
138 0.18
139 0.18
140 0.16
141 0.16
142 0.16
143 0.14
144 0.17
145 0.17
146 0.15
147 0.16
148 0.18
149 0.17
150 0.17
151 0.17
152 0.19
153 0.2
154 0.23
155 0.23
156 0.3
157 0.35
158 0.43
159 0.43
160 0.44
161 0.42
162 0.4
163 0.39
164 0.33
165 0.3
166 0.23
167 0.22
168 0.18
169 0.18
170 0.17
171 0.16
172 0.13
173 0.09
174 0.07
175 0.05
176 0.06
177 0.05
178 0.05
179 0.06
180 0.06
181 0.1
182 0.18
183 0.24
184 0.29
185 0.33
186 0.35
187 0.36
188 0.39
189 0.44
190 0.44
191 0.43
192 0.4
193 0.42
194 0.44
195 0.44
196 0.43
197 0.44
198 0.4
199 0.45
200 0.49
201 0.51
202 0.53
203 0.57
204 0.57
205 0.52
206 0.55
207 0.47
208 0.43
209 0.35
210 0.29
211 0.27
212 0.25
213 0.23
214 0.13
215 0.12
216 0.11
217 0.12
218 0.12
219 0.09
220 0.1
221 0.1
222 0.12
223 0.15
224 0.16
225 0.15
226 0.24
227 0.31
228 0.31
229 0.31
230 0.3
231 0.27
232 0.29
233 0.31
234 0.23
235 0.21
236 0.25
237 0.27
238 0.28
239 0.28
240 0.24
241 0.22
242 0.21
243 0.16
244 0.1
245 0.09
246 0.09
247 0.11
248 0.14
249 0.16
250 0.19
251 0.25
252 0.31
253 0.34
254 0.38
255 0.46
256 0.54
257 0.61
258 0.66
259 0.66
260 0.66
261 0.64
262 0.63
263 0.59
264 0.51
265 0.42
266 0.37
267 0.35
268 0.31
269 0.3
270 0.3
271 0.31
272 0.38
273 0.47
274 0.5
275 0.56
276 0.64
277 0.69
278 0.68
279 0.72
280 0.67
281 0.69
282 0.72
283 0.67
284 0.66
285 0.67
286 0.7