Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397T9X3

Protein Details
Accession A0A397T9X3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
80-101IVAACYCKRNRTRNTSNMRMDYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, plas 7, E.R. 4, extr 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYLTTNLLNNLNNLQRIIKKYSLILLLLLNIFINDNSLVFGDDTSNGGNNEVGTRGINLNSPIPIGIGVGCAAIIIIIAIVAACYCKRNRTRNTSNMRMDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.27
3 0.31
4 0.35
5 0.33
6 0.3
7 0.3
8 0.33
9 0.31
10 0.26
11 0.23
12 0.17
13 0.15
14 0.14
15 0.13
16 0.09
17 0.07
18 0.07
19 0.05
20 0.06
21 0.05
22 0.05
23 0.05
24 0.05
25 0.06
26 0.06
27 0.06
28 0.05
29 0.06
30 0.06
31 0.06
32 0.07
33 0.07
34 0.07
35 0.07
36 0.06
37 0.06
38 0.06
39 0.06
40 0.05
41 0.06
42 0.06
43 0.07
44 0.08
45 0.09
46 0.09
47 0.09
48 0.09
49 0.08
50 0.07
51 0.07
52 0.06
53 0.05
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.03
60 0.03
61 0.03
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.03
70 0.04
71 0.08
72 0.1
73 0.19
74 0.28
75 0.38
76 0.48
77 0.57
78 0.67
79 0.74
80 0.82
81 0.83