Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SXZ2

Protein Details
Accession A0A397SXZ2   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
75-96VLTSYWYKERKNKKIKEFSAPVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11.5, cyto 10.5, nucl 7.5, mito 4, plas 2, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MEEPILPEFPEPPPIEPKPVGETNSGSKTIPIYPGNKTYNNTGGNMNENTGTDNNGGLISVIIVMVILALLAIAVLTSYWYKERKNKKIKEFSAPVTPVTENISRNERIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.36
3 0.35
4 0.37
5 0.35
6 0.38
7 0.37
8 0.32
9 0.32
10 0.32
11 0.35
12 0.33
13 0.27
14 0.24
15 0.23
16 0.22
17 0.24
18 0.22
19 0.21
20 0.23
21 0.3
22 0.34
23 0.35
24 0.35
25 0.34
26 0.37
27 0.35
28 0.33
29 0.27
30 0.25
31 0.26
32 0.24
33 0.21
34 0.15
35 0.13
36 0.14
37 0.12
38 0.12
39 0.09
40 0.08
41 0.08
42 0.07
43 0.07
44 0.05
45 0.05
46 0.03
47 0.03
48 0.03
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.01
55 0.01
56 0.01
57 0.01
58 0.01
59 0.01
60 0.01
61 0.01
62 0.01
63 0.03
64 0.03
65 0.05
66 0.08
67 0.12
68 0.17
69 0.26
70 0.37
71 0.47
72 0.58
73 0.66
74 0.74
75 0.82
76 0.83
77 0.84
78 0.79
79 0.73
80 0.72
81 0.64
82 0.54
83 0.47
84 0.42
85 0.33
86 0.31
87 0.31
88 0.23
89 0.26
90 0.3