Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SS08

Protein Details
Accession A0A397SS08   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
24-45AELIKMKSKKRIQINKLRAEALHydrophilic
NLS Segment(s)
PositionSequence
30-57KSKKRIQINKLRAEALAKGDTKLLKKTK
Subcellular Location(s) nucl 11, mito 9, extr 4, cyto 3
Family & Domain DBs
Amino Acid Sequences MNKVSFFLRAILIKYIYHSIYRIAELIKMKSKKRIQINKLRAEALAKGDTKLLKKTKGGGIIPPKEPTLPVVINDPPAPTYAHMGVPPPYGSRPGSPNIGVLSRPGTPGYPSRTGTPVYRPGTPSSRPGTPGYGQVNPYGLPNGQQPAPVLSRRNSGSSVMSGMTNVSAYTTSYGPGGNRPYGPPNRSQTPPTIQSKRDNLIARAVLNNTEKQNSTPSEKSDDDDRYSEYGGSQFSLGDNTGSKPLLNKYNEYDLYRAPSPARSYSPTPSVSSTTSNPRSRPPNGPHGAYPLRYQQDHRPPRYNNYAQQGGGPNRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.27
3 0.24
4 0.24
5 0.22
6 0.22
7 0.23
8 0.23
9 0.23
10 0.19
11 0.23
12 0.25
13 0.3
14 0.35
15 0.39
16 0.41
17 0.49
18 0.56
19 0.59
20 0.66
21 0.72
22 0.73
23 0.78
24 0.85
25 0.84
26 0.81
27 0.74
28 0.64
29 0.55
30 0.48
31 0.42
32 0.38
33 0.29
34 0.25
35 0.28
36 0.31
37 0.31
38 0.36
39 0.37
40 0.36
41 0.38
42 0.43
43 0.45
44 0.49
45 0.48
46 0.48
47 0.52
48 0.53
49 0.53
50 0.49
51 0.45
52 0.37
53 0.36
54 0.29
55 0.25
56 0.2
57 0.18
58 0.2
59 0.21
60 0.22
61 0.23
62 0.21
63 0.15
64 0.16
65 0.16
66 0.12
67 0.14
68 0.14
69 0.15
70 0.15
71 0.16
72 0.16
73 0.17
74 0.17
75 0.15
76 0.14
77 0.17
78 0.17
79 0.19
80 0.2
81 0.21
82 0.24
83 0.23
84 0.23
85 0.21
86 0.21
87 0.18
88 0.16
89 0.16
90 0.13
91 0.13
92 0.12
93 0.11
94 0.12
95 0.17
96 0.22
97 0.24
98 0.25
99 0.26
100 0.27
101 0.29
102 0.29
103 0.3
104 0.33
105 0.3
106 0.32
107 0.32
108 0.33
109 0.37
110 0.36
111 0.36
112 0.31
113 0.31
114 0.31
115 0.3
116 0.31
117 0.26
118 0.3
119 0.28
120 0.27
121 0.26
122 0.24
123 0.23
124 0.2
125 0.19
126 0.14
127 0.11
128 0.09
129 0.09
130 0.11
131 0.1
132 0.11
133 0.11
134 0.12
135 0.15
136 0.16
137 0.17
138 0.16
139 0.2
140 0.2
141 0.22
142 0.2
143 0.19
144 0.18
145 0.16
146 0.15
147 0.12
148 0.11
149 0.09
150 0.08
151 0.07
152 0.06
153 0.05
154 0.04
155 0.04
156 0.04
157 0.06
158 0.06
159 0.06
160 0.06
161 0.07
162 0.07
163 0.11
164 0.13
165 0.13
166 0.14
167 0.15
168 0.22
169 0.28
170 0.29
171 0.32
172 0.35
173 0.38
174 0.39
175 0.4
176 0.38
177 0.38
178 0.43
179 0.44
180 0.45
181 0.44
182 0.48
183 0.51
184 0.48
185 0.49
186 0.45
187 0.38
188 0.37
189 0.35
190 0.3
191 0.27
192 0.25
193 0.22
194 0.21
195 0.23
196 0.2
197 0.21
198 0.2
199 0.2
200 0.24
201 0.23
202 0.28
203 0.27
204 0.28
205 0.32
206 0.32
207 0.33
208 0.34
209 0.35
210 0.31
211 0.3
212 0.3
213 0.25
214 0.25
215 0.23
216 0.18
217 0.15
218 0.13
219 0.12
220 0.1
221 0.09
222 0.08
223 0.09
224 0.09
225 0.08
226 0.09
227 0.09
228 0.12
229 0.12
230 0.12
231 0.13
232 0.18
233 0.25
234 0.27
235 0.28
236 0.3
237 0.39
238 0.42
239 0.42
240 0.39
241 0.33
242 0.36
243 0.34
244 0.32
245 0.25
246 0.26
247 0.28
248 0.3
249 0.32
250 0.32
251 0.35
252 0.38
253 0.43
254 0.41
255 0.39
256 0.37
257 0.36
258 0.34
259 0.33
260 0.32
261 0.36
262 0.43
263 0.46
264 0.45
265 0.5
266 0.55
267 0.57
268 0.63
269 0.6
270 0.62
271 0.62
272 0.64
273 0.58
274 0.59
275 0.58
276 0.5
277 0.47
278 0.45
279 0.44
280 0.43
281 0.45
282 0.47
283 0.53
284 0.61
285 0.66
286 0.67
287 0.66
288 0.73
289 0.79
290 0.77
291 0.74
292 0.72
293 0.69
294 0.6
295 0.61
296 0.61