Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397T3S6

Protein Details
Accession A0A397T3S6   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
59-84YQNSNTKITNKKRNYSSKKSFRNSLHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036691  Endo/exonu/phosph_ase_sf  
Gene Ontology GO:0004519  F:endonuclease activity  
GO:0004527  F:exonuclease activity  
Amino Acid Sequences MNLQPNSNDILYNNLISNDYTDTVKRTTPLHDTNPTQIDLTHTSTPINNLNPTDSLNNYQNSNTKITNKKRNYSSKKSFRNSLHSINNINGPNDPLSMEQINIETLNIRRDYQNKLNDIDNLISMHDLDILSLTETGLHSSNKIYNKARSITNVNNNLNYNYFTLHDNTGSTKGSGTSLILKESLFNHVIAHSSFKGRVLHVDLLYRRKQMIRIISVYLPAGNSKKHQTLTTDIHNHLNSLMNTSSNYSFIILGDFNVDPKNKLPPPTTTNNEWPDDDNEEDTQHITKQHINK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.19
3 0.18
4 0.2
5 0.16
6 0.15
7 0.16
8 0.16
9 0.19
10 0.2
11 0.22
12 0.21
13 0.21
14 0.24
15 0.31
16 0.37
17 0.41
18 0.46
19 0.47
20 0.52
21 0.53
22 0.5
23 0.41
24 0.35
25 0.32
26 0.29
27 0.31
28 0.26
29 0.23
30 0.23
31 0.24
32 0.27
33 0.27
34 0.26
35 0.25
36 0.23
37 0.25
38 0.25
39 0.27
40 0.26
41 0.23
42 0.25
43 0.26
44 0.27
45 0.26
46 0.27
47 0.3
48 0.3
49 0.32
50 0.3
51 0.34
52 0.42
53 0.5
54 0.58
55 0.61
56 0.66
57 0.71
58 0.79
59 0.81
60 0.82
61 0.83
62 0.83
63 0.86
64 0.83
65 0.82
66 0.76
67 0.75
68 0.71
69 0.68
70 0.64
71 0.57
72 0.54
73 0.47
74 0.48
75 0.4
76 0.35
77 0.27
78 0.22
79 0.19
80 0.18
81 0.17
82 0.11
83 0.13
84 0.12
85 0.12
86 0.11
87 0.1
88 0.1
89 0.09
90 0.09
91 0.08
92 0.08
93 0.12
94 0.12
95 0.13
96 0.15
97 0.18
98 0.26
99 0.32
100 0.37
101 0.36
102 0.37
103 0.37
104 0.36
105 0.34
106 0.28
107 0.2
108 0.15
109 0.12
110 0.1
111 0.09
112 0.07
113 0.06
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.04
122 0.04
123 0.06
124 0.07
125 0.07
126 0.07
127 0.08
128 0.13
129 0.15
130 0.2
131 0.22
132 0.23
133 0.27
134 0.29
135 0.29
136 0.28
137 0.31
138 0.32
139 0.37
140 0.42
141 0.39
142 0.39
143 0.39
144 0.37
145 0.32
146 0.27
147 0.2
148 0.13
149 0.13
150 0.12
151 0.13
152 0.12
153 0.12
154 0.11
155 0.12
156 0.13
157 0.13
158 0.12
159 0.1
160 0.1
161 0.1
162 0.1
163 0.09
164 0.12
165 0.12
166 0.13
167 0.13
168 0.12
169 0.13
170 0.14
171 0.17
172 0.12
173 0.12
174 0.12
175 0.11
176 0.13
177 0.12
178 0.14
179 0.12
180 0.13
181 0.13
182 0.16
183 0.17
184 0.16
185 0.19
186 0.2
187 0.23
188 0.22
189 0.28
190 0.28
191 0.33
192 0.36
193 0.35
194 0.32
195 0.29
196 0.32
197 0.32
198 0.36
199 0.35
200 0.34
201 0.36
202 0.35
203 0.34
204 0.31
205 0.26
206 0.18
207 0.16
208 0.16
209 0.15
210 0.17
211 0.22
212 0.26
213 0.28
214 0.29
215 0.3
216 0.35
217 0.39
218 0.45
219 0.45
220 0.42
221 0.46
222 0.44
223 0.41
224 0.35
225 0.35
226 0.26
227 0.24
228 0.22
229 0.17
230 0.18
231 0.21
232 0.2
233 0.16
234 0.16
235 0.13
236 0.13
237 0.12
238 0.13
239 0.1
240 0.1
241 0.12
242 0.11
243 0.12
244 0.16
245 0.16
246 0.16
247 0.18
248 0.27
249 0.27
250 0.33
251 0.35
252 0.39
253 0.45
254 0.53
255 0.57
256 0.55
257 0.6
258 0.6
259 0.59
260 0.54
261 0.5
262 0.45
263 0.44
264 0.39
265 0.33
266 0.29
267 0.26
268 0.25
269 0.23
270 0.21
271 0.18
272 0.19
273 0.18