Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397T920

Protein Details
Accession A0A397T920   
Localization Confidence High
Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
64-89SAERFRRIFRRRVNRRFRQRLRLIPIHydrophilic
NLS Segment(s)
PositionSequence
70-81RIFRRRVNRRFR
Subcellular Location(s) nucl 19, mito 3, cyto 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001005  SANT/Myb  
Pfam View protein in Pfam  
PF00249  Myb_DNA-binding  
PROSITE View protein in PROSITE  
PS50090  MYB_LIKE  
CDD cd00167  SANT  
Amino Acid Sequences MDNNNNNQWNLQLPRHPWRVREDTELIMLVHFIGIGDWIQISNVLGRSPSQCRRRYFNLIALGSAERFRRIFRRRVNRRFRQRLRLIPIGGMFQRIQLLAQQNTNGRRMDLNFILNTPQDPRMNINYILNVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.55
3 0.57
4 0.54
5 0.56
6 0.6
7 0.57
8 0.58
9 0.52
10 0.44
11 0.43
12 0.4
13 0.32
14 0.23
15 0.19
16 0.12
17 0.09
18 0.06
19 0.04
20 0.03
21 0.03
22 0.03
23 0.04
24 0.04
25 0.04
26 0.04
27 0.04
28 0.05
29 0.06
30 0.06
31 0.06
32 0.07
33 0.08
34 0.11
35 0.18
36 0.26
37 0.33
38 0.39
39 0.43
40 0.49
41 0.55
42 0.6
43 0.57
44 0.55
45 0.54
46 0.47
47 0.43
48 0.38
49 0.32
50 0.23
51 0.22
52 0.16
53 0.09
54 0.1
55 0.11
56 0.19
57 0.24
58 0.32
59 0.39
60 0.5
61 0.6
62 0.7
63 0.8
64 0.81
65 0.88
66 0.9
67 0.89
68 0.88
69 0.85
70 0.83
71 0.79
72 0.75
73 0.65
74 0.55
75 0.49
76 0.41
77 0.33
78 0.27
79 0.2
80 0.14
81 0.14
82 0.12
83 0.11
84 0.12
85 0.18
86 0.17
87 0.19
88 0.21
89 0.25
90 0.28
91 0.32
92 0.28
93 0.24
94 0.25
95 0.26
96 0.29
97 0.27
98 0.29
99 0.26
100 0.26
101 0.27
102 0.25
103 0.24
104 0.21
105 0.24
106 0.22
107 0.23
108 0.28
109 0.31
110 0.35
111 0.36
112 0.35