Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397TM08

Protein Details
Accession A0A397TM08    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
13-32SIEQKLRKIKEDQKKIKETIHydrophilic
NLS Segment(s)
PositionSequence
17-29KLRKIKEDQKKIK
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR003395  RecF/RecN/SMC_N  
Gene Ontology GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF02463  SMC_N  
Amino Acid Sequences MSIIESMEKKKESIEQKLRKIKEDQKKIKETIDKLDKEREKSLRKTWEQVNTEFGIIFSEMLPXSFAKIQPLEGQDITDGLEVKVRLGGVWKQSLSELSGGQRTLVALSLILAILKYKPAPIYILDEIDAALDISHTQNIGHLIRTRFKESQFIIVSLKDGMFSNANVIFRTRFRDGTSVVESSQRAGTSNSNRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.56
3 0.65
4 0.75
5 0.75
6 0.73
7 0.74
8 0.73
9 0.73
10 0.75
11 0.75
12 0.75
13 0.8
14 0.78
15 0.77
16 0.75
17 0.68
18 0.67
19 0.66
20 0.6
21 0.56
22 0.63
23 0.6
24 0.57
25 0.61
26 0.6
27 0.58
28 0.6
29 0.65
30 0.65
31 0.64
32 0.66
33 0.65
34 0.65
35 0.61
36 0.56
37 0.52
38 0.43
39 0.39
40 0.33
41 0.26
42 0.17
43 0.13
44 0.12
45 0.07
46 0.08
47 0.07
48 0.09
49 0.09
50 0.08
51 0.11
52 0.12
53 0.15
54 0.13
55 0.15
56 0.18
57 0.19
58 0.21
59 0.18
60 0.17
61 0.15
62 0.15
63 0.14
64 0.1
65 0.09
66 0.06
67 0.08
68 0.08
69 0.08
70 0.08
71 0.08
72 0.07
73 0.09
74 0.11
75 0.11
76 0.14
77 0.14
78 0.13
79 0.13
80 0.14
81 0.13
82 0.11
83 0.09
84 0.08
85 0.1
86 0.09
87 0.09
88 0.09
89 0.08
90 0.07
91 0.06
92 0.05
93 0.03
94 0.04
95 0.04
96 0.04
97 0.04
98 0.03
99 0.03
100 0.04
101 0.05
102 0.05
103 0.05
104 0.06
105 0.07
106 0.08
107 0.09
108 0.15
109 0.15
110 0.16
111 0.15
112 0.15
113 0.14
114 0.13
115 0.11
116 0.05
117 0.04
118 0.03
119 0.04
120 0.04
121 0.05
122 0.05
123 0.05
124 0.06
125 0.1
126 0.1
127 0.13
128 0.17
129 0.2
130 0.26
131 0.3
132 0.35
133 0.35
134 0.36
135 0.4
136 0.37
137 0.42
138 0.39
139 0.37
140 0.32
141 0.29
142 0.29
143 0.22
144 0.2
145 0.13
146 0.11
147 0.12
148 0.11
149 0.11
150 0.14
151 0.16
152 0.17
153 0.16
154 0.18
155 0.18
156 0.19
157 0.26
158 0.26
159 0.25
160 0.27
161 0.32
162 0.32
163 0.36
164 0.38
165 0.33
166 0.3
167 0.32
168 0.29
169 0.27
170 0.28
171 0.22
172 0.18
173 0.19
174 0.27