Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SFJ9

Protein Details
Accession A0A397SFJ9   
Localization Confidence High
Confidence Score 17.7
NoLS Segment(s)
PositionSequenceProtein Nature
107-130DYLDDFPKKRNKRNKNVNKNSEPLHydrophilic
138-159DLPKEGNKRNKKLTKMKIRSLMHydrophilic
NLS Segment(s)
PositionSequence
116-118RNK
146-149RNKK
Subcellular Location(s) nucl 22, cyto_nucl 13.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MSRVSGKDKKPDIGDIYRESKKACEEYEACLTTTIYGDTYLDPEKCKARGFDPKKACEEEDERLKLGIEWIERTIKEKGFHAQFEKFLDKVPSKYASKDPKSLAYFDYLDDFPKKRNKRNKNVNKNSEPLACFNDLDDLPKEGNKRNKKLTKMKIRSLMVKASYLVSRKVKHDDELDIKFVKVISVKINEDGVFLEVKEKVGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.52
3 0.54
4 0.52
5 0.5
6 0.45
7 0.41
8 0.39
9 0.38
10 0.33
11 0.34
12 0.32
13 0.36
14 0.42
15 0.41
16 0.35
17 0.32
18 0.31
19 0.23
20 0.22
21 0.17
22 0.1
23 0.09
24 0.09
25 0.08
26 0.11
27 0.14
28 0.15
29 0.16
30 0.18
31 0.22
32 0.23
33 0.25
34 0.25
35 0.28
36 0.38
37 0.43
38 0.5
39 0.54
40 0.58
41 0.6
42 0.6
43 0.55
44 0.49
45 0.47
46 0.43
47 0.43
48 0.39
49 0.35
50 0.33
51 0.32
52 0.26
53 0.23
54 0.2
55 0.13
56 0.12
57 0.13
58 0.16
59 0.16
60 0.19
61 0.21
62 0.21
63 0.21
64 0.21
65 0.26
66 0.26
67 0.29
68 0.29
69 0.27
70 0.26
71 0.29
72 0.29
73 0.23
74 0.22
75 0.23
76 0.21
77 0.2
78 0.22
79 0.23
80 0.22
81 0.24
82 0.3
83 0.36
84 0.37
85 0.41
86 0.39
87 0.41
88 0.41
89 0.4
90 0.33
91 0.26
92 0.24
93 0.19
94 0.21
95 0.14
96 0.14
97 0.16
98 0.16
99 0.17
100 0.26
101 0.32
102 0.38
103 0.49
104 0.58
105 0.66
106 0.77
107 0.84
108 0.86
109 0.91
110 0.92
111 0.86
112 0.78
113 0.71
114 0.64
115 0.54
116 0.45
117 0.38
118 0.29
119 0.24
120 0.21
121 0.21
122 0.16
123 0.18
124 0.16
125 0.14
126 0.14
127 0.16
128 0.19
129 0.22
130 0.32
131 0.39
132 0.45
133 0.53
134 0.6
135 0.68
136 0.76
137 0.8
138 0.81
139 0.8
140 0.81
141 0.8
142 0.76
143 0.73
144 0.67
145 0.62
146 0.53
147 0.46
148 0.38
149 0.32
150 0.32
151 0.27
152 0.3
153 0.3
154 0.31
155 0.34
156 0.41
157 0.41
158 0.42
159 0.43
160 0.44
161 0.45
162 0.45
163 0.45
164 0.38
165 0.36
166 0.32
167 0.29
168 0.23
169 0.18
170 0.17
171 0.19
172 0.24
173 0.25
174 0.27
175 0.3
176 0.28
177 0.26
178 0.25
179 0.2
180 0.15
181 0.13
182 0.14
183 0.12