Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SY25

Protein Details
Accession A0A397SY25    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
137-164NGKVKKVMKTVHKRSKGKFSKVQKSVINHydrophilic
NLS Segment(s)
PositionSequence
136-155GNGKVKKVMKTVHKRSKGKF
Subcellular Location(s) nucl 14.5, mito_nucl 11.666, cyto_nucl 10.333, mito 7.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MTSSISNYTRPTPIASSSSQQRHPTSSSLSLTTSTPDKKLQTLIETSIPSTSASLAILDNSSLLFPYQHIRKRDTIRKMRTLSHNNSYNKQSTRISQTLEHSGTISKNSNSDDNSLAACSCQGCILGVLKKRVMSGNGKVKKVMKTVHKRSKGKFSKVQKSVINNKDVTV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.32
4 0.38
5 0.43
6 0.46
7 0.5
8 0.48
9 0.48
10 0.48
11 0.46
12 0.43
13 0.42
14 0.37
15 0.33
16 0.31
17 0.28
18 0.26
19 0.25
20 0.25
21 0.21
22 0.22
23 0.24
24 0.25
25 0.25
26 0.29
27 0.29
28 0.27
29 0.28
30 0.28
31 0.27
32 0.26
33 0.24
34 0.21
35 0.19
36 0.15
37 0.13
38 0.11
39 0.07
40 0.07
41 0.07
42 0.07
43 0.06
44 0.06
45 0.06
46 0.05
47 0.05
48 0.05
49 0.04
50 0.04
51 0.04
52 0.05
53 0.1
54 0.16
55 0.22
56 0.25
57 0.29
58 0.35
59 0.44
60 0.52
61 0.57
62 0.6
63 0.61
64 0.67
65 0.66
66 0.65
67 0.65
68 0.65
69 0.6
70 0.58
71 0.59
72 0.53
73 0.53
74 0.51
75 0.47
76 0.4
77 0.38
78 0.32
79 0.27
80 0.32
81 0.31
82 0.3
83 0.28
84 0.29
85 0.31
86 0.31
87 0.28
88 0.21
89 0.2
90 0.18
91 0.18
92 0.18
93 0.13
94 0.14
95 0.16
96 0.18
97 0.18
98 0.2
99 0.18
100 0.17
101 0.17
102 0.15
103 0.13
104 0.11
105 0.1
106 0.08
107 0.07
108 0.06
109 0.06
110 0.05
111 0.07
112 0.1
113 0.15
114 0.19
115 0.22
116 0.23
117 0.24
118 0.26
119 0.27
120 0.28
121 0.29
122 0.34
123 0.41
124 0.46
125 0.47
126 0.49
127 0.52
128 0.52
129 0.52
130 0.5
131 0.5
132 0.55
133 0.65
134 0.71
135 0.77
136 0.8
137 0.8
138 0.85
139 0.84
140 0.82
141 0.8
142 0.8
143 0.81
144 0.79
145 0.8
146 0.76
147 0.75
148 0.77
149 0.74
150 0.71