Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397SU62

Protein Details
Accession A0A397SU62    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
21-59EKSNSRKKSKPMQPRACSRCRQIKKRCDRNRPCGRCIKSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MFSSQNSEMQSIEQDDNTTVEKSNSRKKSKPMQPRACSRCRQIKKRCDRNRPCGRCIKSNLTHNCDAGKTDSEEQQH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.17
4 0.17
5 0.16
6 0.13
7 0.13
8 0.17
9 0.22
10 0.31
11 0.39
12 0.45
13 0.49
14 0.55
15 0.64
16 0.7
17 0.75
18 0.77
19 0.78
20 0.77
21 0.83
22 0.82
23 0.79
24 0.73
25 0.68
26 0.67
27 0.65
28 0.69
29 0.68
30 0.72
31 0.76
32 0.83
33 0.88
34 0.88
35 0.89
36 0.9
37 0.91
38 0.88
39 0.83
40 0.82
41 0.76
42 0.73
43 0.71
44 0.69
45 0.65
46 0.68
47 0.7
48 0.67
49 0.65
50 0.58
51 0.54
52 0.45
53 0.4
54 0.33
55 0.28
56 0.26
57 0.26