Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A397T546

Protein Details
Accession A0A397T546    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-33LDEECKKKASNEIRQRNREKKPRDQDLPGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MDAFLDEECKKKASNEIRQRNREKKPRDQDLPGTSALGIDIQKTVYNQSHVTSEVEVLERLPYLSLIYSMDYSDNFGFNSSVPCPICNKDHKSENIKNGIGGRWGYGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.53
3 0.63
4 0.72
5 0.81
6 0.89
7 0.89
8 0.89
9 0.88
10 0.85
11 0.85
12 0.85
13 0.85
14 0.81
15 0.77
16 0.75
17 0.7
18 0.65
19 0.54
20 0.44
21 0.34
22 0.27
23 0.21
24 0.14
25 0.09
26 0.06
27 0.06
28 0.06
29 0.07
30 0.08
31 0.1
32 0.1
33 0.12
34 0.13
35 0.13
36 0.14
37 0.14
38 0.15
39 0.12
40 0.11
41 0.1
42 0.09
43 0.08
44 0.07
45 0.06
46 0.06
47 0.05
48 0.05
49 0.04
50 0.04
51 0.04
52 0.05
53 0.05
54 0.06
55 0.06
56 0.07
57 0.07
58 0.07
59 0.1
60 0.1
61 0.1
62 0.09
63 0.09
64 0.09
65 0.09
66 0.12
67 0.1
68 0.15
69 0.15
70 0.17
71 0.19
72 0.22
73 0.28
74 0.34
75 0.4
76 0.42
77 0.5
78 0.56
79 0.63
80 0.67
81 0.7
82 0.69
83 0.63
84 0.58
85 0.53
86 0.47
87 0.41
88 0.34